KEGG   Secondary endosymbiont of Heteropsylla cubana: A35E_00085Help
Entry
A35E_00085        CDS       T02336                                 

Definition
(GenBank) enoyl-(acyl-carrier-protein) reductase (NADH)
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
sehc  Secondary endosymbiont of Heteropsylla cubana
Pathway
sehc00061  Fatty acid biosynthesis
sehc00780  Biotin metabolism
sehc01100  Metabolic pathways
sehc01130  Biosynthesis of antibiotics
sehc01212  Fatty acid metabolism
Module
sehc_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:sehc00001]
 Metabolism
  Lipid metabolism
   00061 Fatty acid biosynthesis
    A35E_00085
  Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    A35E_00085
  Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosyntheses
    A35E_00085
Enzymes [BR:sehc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     A35E_00085
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     A35E_00085
Lipid biosynthesis proteins [BR:sehc01004]
 Fatty acid synthase
  Component type
   A35E_00085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Enoyl_reductase
Motif
Other DBs
NCBI-ProteinID: AFP85407
UniProt: J3TG97
Position
complement(165723..166511)
Genome map
AA seq 262 aa AA seqDB search
MSFLAGKRILVTGIVSDRSIAFGIAQAMHREQAELAFTYQSVKFKSRIEGFAAKFNSKIV
LPCDVAQDSSIDALFSNLADIWPSFDGFVHAIAYAPSDQLEGDYVNVVTREGFAIAHDIS
AYSFVALAKSCRKMLRPNAALLTLTYLGSERAIPYYNVMGLAKASLEANTRYMANAMGKQ
GVRVNAISAGPIRTLAASGIKNFKNMLAAVKEATPVRDVITIENIGNVAAFLCSDLSSGI
TGEVIHVDGGFNIVAMNAPDLD
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgagctttcttgcaggtaagcgtattttagtcactggtattgtaagcgatcgatctatc
gcgtttggtattgctcaggcaatgcaccgtgagcaagcagagcttgcttttacttatcaa
agtgttaaattcaaatcacgcatagaaggctttgctgctaaatttaattctaaaattgta
ttaccgtgtgatgtggcacaagatagtagtatcgatgctctgtttagtaatttagcagat
atttggcctagttttgacgggtttgtacacgcgattgcttatgctcctagtgaccaatta
gaaggtgattatgttaatgttgttactcgagagggtttcgcaatcgcacatgatatcagc
gcgtacagtttcgtggctttagctaaatcttgccgaaaaatgctacgccctaatgctgcc
cttttaacattaacttatttaggttcggaacgtgccatcccttactacaatgttatgggt
cttgctaaagcttctttagaagctaacactcggtatatggctaatgctatggggaaacaa
ggtgttcgagtaaacgctatatctgccggtcctattcgtactttagctgcatctggtatc
aagaattttaagaatatgcttgctgcagttaaagaagcaactcctgttcgagatgttatt
actatagaaaacattggaaatgttgctgcttttttatgttctgatctgtcttcggggatt
actggtgaagtgatacatgtagatggtggttttaatattgtagctatgaatgcaccggat
ctagattga

DBGET integrated database retrieval system