KEGG   Secondary endosymbiont of Heteropsylla cubana: A35E_00086Help
Entry
A35E_00086        CDS       T02336                                 

Definition
(GenBank) pantetheine-phosphate adenylyltransferase
  KO
K00954  
pantetheine-phosphate adenylyltransferase [EC:2.7.7.3]
Organism
sehc  Secondary endosymbiont of Heteropsylla cubana
Pathway
Pantothenate and CoA biosynthesis
Metabolic pathways
Module
Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:sehc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    A35E_00086
Enzymes [BR:sehc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.3  pantetheine-phosphate adenylyltransferase
     A35E_00086
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(168206..168691)
Genome map
AA seq 161 aa AA seqDB search
MIKKAIYPGTFDPITNGHLDLLTRATKIFDIVVLAISANPQKCPLFNLKERLSMAIQVTS
HLPTVRVAAFSNLIVDFARHQKGNILIRGVRTIMDVNYEMQLAKMNRYFMPTLETVFMLS
DQDWSYVSSSLVKDVALHGGDVDYFLPEFIAKELQEKLSIS
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgataaaaaaagctatttatccaggtactttcgatccgataactaatggacatctggat
ttattaactcgtgctacaaaaatatttgatattgttgtgcttgccatttctgctaatcca
caaaaatgtccactttttaatttaaaagaacgtctttccatggccatccaagtcacttcg
catttgcctacagtaagagttgcagcttttagtaacttgatagtagattttgctcggcac
cagaaaggaaatatacttattcgaggggtgcgtacaattatggatgtcaattatgaaatg
cagctagcaaaaatgaatcgatattttatgccgaccttagagacggtttttatgttgtcg
gatcaggattggtcttatgtttcttctagtcttgtaaaagatgtggcgctgcacggtgga
gatgtagattactttttgcccgagtttattgctaaggaacttcaggaaaagttaagtatt
tcatga

DBGET integrated database retrieval system