KEGG   Secondary endosymbiont of Heteropsylla cubana: A35E_00097Help
Entry
A35E_00097        CDS       T02336                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sehc  Secondary endosymbiont of Heteropsylla cubana
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:sehc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A35E_00097
   00051 Fructose and mannose metabolism
    A35E_00097
   00562 Inositol phosphate metabolism
    A35E_00097
Enzymes [BR:sehc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     A35E_00097
Exosome [BR:sehc04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   A35E_00097
  Exosomal proteins of bladder cancer cells
   A35E_00097
  Exosomal proteins of melanoma cells
   A35E_00097
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
187862..188626
Genome map
AA seq 254 aa AA seqDB search
MRNYLIIGNWKLNGTKEIINNRALMLRSKINNTINCDVAVAPPLPYLHLTQHYLKDTNIA
LCAQNIDIHTSGAYTGDISPKMLKDIGAKYSIIGHSERRLYHKENNELIAEKFAVLKKSG
LIPVLCIGESEEERRSGQTQKICINQIDAIINKVGITAFQNSVIAYEPIWAIGTGKAALP
SQAQKIHEFIRSYINEYDSESAKQVIIQYGGSVNIDNAAALFNQPDVDGALIGSASLNPD
IFSILVKIALERKK
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgcgaaactatttaataatcggtaattggaagcttaatggtactaaagaaataatcaat
aatcgcgcactcatgttacgcagtaaaataaataacactattaattgtgatgtagcagtt
gcaccaccactcccttatcttcaccttacacagcactatctgaaagataccaacattgcg
ctatgtgcgcaaaacatcgacatccacacctccggggcttatactggtgatatctcccct
aaaatgcttaaagatattggcgctaaatatagtatcattggtcactctgaacgccgtctt
tatcataaagaaaataatgaacttattgccgaaaaatttgcggtattaaaaaaaagtggt
ttaattccagtattatgtataggtgaaagtgaagaggaaagaagatcgggacaaactcaa
aaaatttgtattaatcaaattgatgcaataatcaataaagttggtatcacagcatttcaa
aattctgttattgcctatgagcctatttgggctattggaactggtaaagctgcactacca
agtcaagctcaaaaaatccatgaatttattcgtagttatattaatgaatatgattcagaa
agtgcaaaacaagttattattcaatatggaggatcagtaaacattgacaatgctgctgca
ctctttaatcagccagatgtcgatggtgctctcattggttccgcatcactaaatcctgat
attttttcaatactagttaaaattgctttagaaagaaaaaaataa

DBGET integrated database retrieval system