KEGG   Secondary endosymbiont of Heteropsylla cubana: A35E_00098Help
Entry
A35E_00098        CDS       T02336                                 

Definition
(GenBank) translation initiation factor IF-1
  KO
K02518  
translation initiation factor IF-1
Organism
sehc  Secondary endosymbiont of Heteropsylla cubana
Brite
Translation factors [BR:sehc03012]
 Prokaryotic Type
  Initiation factors
   A35E_00098
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(190170..190388)
Genome map
AA seq 72 aa AA seqDB search
MAKEENIEMQGTVIDTLPNTMFRVELENGHIVTAHISGKMRKNYIRILTSDKVTVELTPY
DLSKGRIVFRSR
NT seq 219 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagaagaaaatattgaaatgcaaggtactgtaatagatacgttacctaacacc
atgtttcgggtagaactggaaaatggacatatagtcactgcacatatatctggtaaaatg
agaaaaaattatattcgcatcttaactagcgataaagtaactgttgagttgactccgtat
gatttaagtaaagggcgtattgtattccgaagtcgttaa

DBGET integrated database retrieval system