KEGG   Secondary endosymbiont of Heteropsylla cubana: A35E_00107Help
Entry
A35E_00107        CDS       T02336                                 

Definition
(GenBank) rod shape-determining protein MreD
  KO
K03571  
rod shape-determining protein MreD
Organism
sehc  Secondary endosymbiont of Heteropsylla cubana
Brite
Chromosome [BR:sehc03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Other chromosome partitioning proteins
    A35E_00107
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(207301..207789)
Genome map
AA seq 162 aa AA seqDB search
MNEYHRDSGWTIWFSFLVGMILQIIPWPFQICFFLPFWTKLLLIYWITVLPHRVNINAAF
ILGLITDIIFGITIGIHALAFTILSYLALLKFHLFRNLTLWQQSLLVLMFSLITDIIIFW
AQFLIMNVEFSSETFWNSVIDGIWWSWIFLTMQKIRRKLSMK
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagtatcaccgtgatagcggctggactatttggttttcattccttgtagggatg
attttacaaattattccttggccttttcaaatatgcttcttccttcctttttggacaaag
ttgttgcttatttattggattacggttttgcctcatagagtcaacattaatgcggcattt
attcttggcttgataacagatataatatttggtattacaataggaatacacgcattggcg
tttactattctttcctatttagcattattaaaatttcacttatttcgaaacctaactctt
tggcaacaatcacttttagtattaatgttttcattaataacagatataatcatattttgg
gcgcaatttttaataatgaatgttgaattttcttcggaaacattttggaatagtgtaata
gatggcatatggtggtcgtggatatttttaacaatgcagaaaatacggcgtaaattaagc
atgaaatga

DBGET integrated database retrieval system