KEGG   Secondary endosymbiont of Heteropsylla cubana: A35E_00108Help
Entry
A35E_00108        CDS       T02336                                 

Definition
(GenBank) rod shape-determining protein MreC
  KO
K03570  rod shape-determining protein MreC
Organism
sehc  Secondary endosymbiont of Heteropsylla cubana
Brite
Chromosome [BR:sehc03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Other chromosome partitioning proteins
    A35E_00108
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MreC
Motif
Other DBs
NCBI-ProteinID: AFP85424
UniProt: J3Z548
Position
complement(208050..208985)
Genome map
AA seq 311 aa AA seqDB search
MKPMFLRPPSLQLRFFLAVMVAITTIIADSHLEVFITLRSYMDTAISPFYFLSNTPRQIF
NHLSKIIIPPFRLVLENEALRQELLIKNSDQLLFGQYKKENARLRQLLNSPLKTNEKKIV
AQVISITNHPHKEQIVIDKGVDNGVYIGQPVISDKGVIGQVISTSKFTSRVLLICDHSHA
LPIQVLRNNIRVIVSGNSCRDNLQLERLPINTDIRIGDLLVTSGLGGRFPEGYPVAVVSS
VNIDSQRAYMLVRARPTADLRRLHYLLLLWDDKMCDKTHESSDVVNRVANKRLMQIISHL
LVSNMTNHTTA
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgaagccaatgttcctcagacctccgtcattgcaactaaggttttttttagcagtcatg
gtagctattactaccattattgctgatagccacttagaggtgtttatcacacttcgatcc
tatatggatacggctattagtcctttttatttcttatcaaatactccacgtcaaatattt
aatcatttgtcgaaaataataataccaccttttaggttagttttagaaaacgaagcatta
cgtcaggagttgctaataaaaaatagtgatcagctattgtttgggcaatataagaaagaa
aacgctcgactacgtcagttgttgaattcgcctttgaaaacgaatgaaaaaaagatagtt
gcccaagttatttcaattactaatcacccccataaggaacaaatagtcattgataagggt
gtcgataatggtgtatatatcggtcagccagttattagtgataaaggcgttataggacaa
gtaatttctacaagcaagtttaccagtcgtgtacttctaatatgcgatcattcccatgca
cttcctattcaggtgcttcgcaacaatatacgagtgattgtttcgggtaatagttgtaga
gataatctacaattagagcgattaccaatcaacacagatattcgtattggtgatttactt
gtgacctctggattgggtggacgttttccagaaggatatccagtagcagtggtatcttca
gttaatattgactctcaacgtgcctacatgcttgttcgagctcgccctactgctgatttg
cggcgattgcattatttactattattgtgggatgataaaatgtgtgataaaacacatgaa
tcttctgatgtagtaaatagggtggcaaataagagattaatgcaaataatatctcacttg
ctagtttctaatatgacaaaccataccactgcttaa

DBGET integrated database retrieval system