KEGG   Secondary endosymbiont of Heteropsylla cubana: A35E_00111Help
Entry
A35E_00111        CDS       T02336                                 

Definition
(GenBank) hemimethylated DNA binding domain protein
  KO
K11940  
heat shock protein HspQ
Organism
sehc  Secondary endosymbiont of Heteropsylla cubana
Brite
Chromosome [BR:sehc03036]
 Prokaryotic Type
  Nucleoid associated proteins
   Other nucreoid associated proteins
    A35E_00111
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(213664..214080)
Genome map
AA seq 138 aa AA seqDB search
MRSLVYSIEPSFLLNYLRPFPIFTAKHSFIGGLMMASKFSIGQQVRHKLLGYLGVIIDVD
PEYSLDKPSLDDIAADNSLRSSPWYHVVMEDEEGKPVHTYLAEAQIAYEAFSVHPEQQTL
DELAESIQLQLQAPRLRN
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
gtgcgatcgcttgtttattctatagagccttcttttcttttaaattatctaaggcctttt
cccattttcactgcaaaacatagtttcatcggaggtcttatgatggcaagtaaatttagc
atagggcagcaagttcggcataaattattaggataccttggagtgattattgatgtagat
ccggagtattcgttagataagccttccttggatgatatcgcggctgataatagccttcga
agctctccatggtatcatgtggtgatggaagatgaggagggaaaaccagttcatacctat
ctagctgaagcccagatagcttatgaagctttctcagttcatcctgaacagcagacatta
gatgagttagctgaatctattcagttacagctacaagcgccacgcttacgaaactaa

DBGET integrated database retrieval system