KEGG   Secondary endosymbiont of Heteropsylla cubana: A35E_00114Help
Entry
A35E_00114        CDS       T02336                                 

Definition
(GenBank) tryptophanyl-tRNA synthetase
  KO
K01867  
tryptophanyl-tRNA synthetase [EC:6.1.1.2]
Organism
sehc  Secondary endosymbiont of Heteropsylla cubana
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:sehc00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    A35E_00114
Enzymes [BR:sehc01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.2  tryptophan---tRNA ligase
     A35E_00114
Amino acid related enzymes [BR:sehc01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   A35E_00114
Transfer RNA biogenesis [BR:sehc03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    A35E_00114
 Prokaryotic Type
    A35E_00114
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(220542..221549)
Genome map
AA seq 335 aa AA seqDB search
MSHPIVFSGMQPSGKLTIGNYIGALRQWVKIQDEYNCFYSIVDLHAITAYQIPNKLSQAT
LDTTAIYLACGIDPSKSVVFVQSHVPEHTQLSWLLNCYTYVSELNRMTQFKYKSACHTAN
INAGLFDYPVLMAADILLYQTNQVPVGEDQKQHLELSQDIAKRFNSLYGNIFTIPQPCIP
TSGARIMSLLDPLKKMSKSDNNSNNLILLLEERKSIFKKIKQAVTDSDVPAIVQYDPVAK
PGISNLLNILSGITGSSVERLEQEFAGKMYYYLKSVVADTLWEMLSGLQARYYIFRDDEA
YLRNILQDGAEKARVKASITLKKVYEVIGFISNKI
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgagtcacccaattgtatttagtggtatgcagccatctggaaaactcactattggaaat
tatattggtgcattacgtcaatgggtgaagatacaagatgaatataattgtttctattct
attgttgatctgcacgctattacggcttatcaaattcctaacaaattaagtcaggcaacg
ttagatacgacagctatttatctagcgtgcggaattgatcccagtaaaagtgtagttttc
gttcaatcacatgtgcctgagcatactcaacttagctggttgctcaattgttatacttat
gttagtgagcttaaccgaatgactcaatttaaatataaatcagcttgtcatactgctaat
attaatgctggtttatttgattatccagtattgatggcggcagatattttgctttatcaa
accaatcaagtcccggtgggagaagatcagaaacagcatcttgagctaagccaggatatt
gctaaacgatttaattcgctttatggaaatatttttactattccgcaaccatgtattcct
acatccggtgcacgaataatgtcattgctagatccattaaaaaagatgtctaaatctgat
aataacagcaataatcttattcttcttttagaagaacgtaagtctatctttaaaaagatt
aaacaggccgtaactgattctgatgtaccagcaatagtgcagtatgatcctgttgcgaaa
ccaggaatatcaaatttgctaaacattttatcaggtataacaggttcttcagtagaaaga
ttagaacaggaatttgctggaaaaatgtattactatctaaaatctgttgtagctgataca
ttatgggagatgctaagtggactacaggcccgttactacatatttcgtgatgatgaagca
tatttacgtaatatattacaagatggagcggagaaagctagagttaaagcgagtataact
ttgaaaaaagtctatgaagttatcggttttatttctaataaaatataa

DBGET integrated database retrieval system