KEGG   Secondary endosymbiont of Heteropsylla cubana: A35E_00123Help
Entry
A35E_00123        CDS       T02336                                 

Definition
(GenBank) birA, biotin-(acetyl-CoA-carboxylase) ligase
  KO
K03524  BirA family transcriptional regulator, biotin operon repressor / biotin---[acetyl-CoA-carboxylase] ligase [EC:6.3.4.15]
Organism
sehc  Secondary endosymbiont of Heteropsylla cubana
Pathway
sehc00780  Biotin metabolism
sehc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sehc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    A35E_00123
Enzymes [BR:sehc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.15  biotin---[biotin carboxyl-carrier protein] ligase
     A35E_00123
Transcription factors [BR:sehc03000]
 Prokaryotic Type
  Helix-turn-helix
   Other families
    A35E_00123
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPL_LplA_LipB BPL_C BPL_LplA_LipB_2 Adeno_Penton_B
Motif
Other DBs
NCBI-ProteinID: AFP85439
UniProt: J3Z558
Position
236742..237698
Genome map
AA seq 318 aa AA seqDB search
MKDVIIPIKLISLLADGNIHSPKEFTLILGKTYIVLEQYIQVIRNWGLDVLIIPNKGYLL
STSLQLLNESIIHTYLPEGQIKVLSIVDSTNQYFIKRIGTIQSGDACLAEFQTKGRGQRG
RTWISPFGYNLYFSLYWHLKKSLMLRGLNLIIAIAIAELLQNIGAIRVRIKWPNDLYLNN
SKLAGILVETSSNAGGYSHAVIGVGINLTMPESVGIKISQNWINLNETGIKIDRNMLAAT
LICTLRRALQEFEENGFAPFFNRWKPLDHLSDRQVILLQGKQRIYGVARGINTKGALLLE
QKGKIQAYCFGEISLYTL
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatgttattattccgataaaactgatcagtttattagctgatggtaacattcat
tcccctaaagagtttactttaattttaggaaaaacctacattgttcttgaacaatacatt
caagtaatacgcaactggggattagatgtcttgatcatacccaataaagggtatctttta
tcaacttctttacagttactaaatgaaagcataattcatacttacttacctgaaggtcag
ataaaagttctttcaattgttgattctacaaatcagtattttattaaacgtattggaacc
atacaaagtggagatgcttgcctagcagaatttcagactaaaggacgcggacaacgcggg
agaacatggatatcaccatttggttataacctatatttttctttatattggcatctaaaa
aaaagccttatgctcagagggttaaatcttataattgctattgcaatagcagagttattg
caaaacataggagctataagagtgcgcattaaatggccgaatgatctctatttaaataat
tctaaactagcaggaattcttgtagaaacttccagtaatgcaggaggttactctcatgct
gtaatcggagttggaattaatttaactatgcctgaaagtgttggaattaaaattagccaa
aattggattaatttaaacgaaacagggattaagattgatcgtaatatgctggcagctaca
ttgatctgcacgttacgaagggcattacaagaattcgaagaaaatggattcgctccattt
tttaaccgatggaaaccattagatcacttatctgatagacaagtaatactattacaaggt
aaacaacgaatttatggagtcgctcgtggcattaatacaaaaggagctctcttgttagaa
caaaaaggaaaaattcaagcttattgttttggagaaatatctctttatactttataa

DBGET integrated database retrieval system