KEGG   Secondary endosymbiont of Heteropsylla cubana: A35E_00136Help
Entry
A35E_00136        CDS       T02336                                 

Definition
(GenBank) peptide chain release factor 2
  KO
K02836  peptide chain release factor 2
Organism
sehc  Secondary endosymbiont of Heteropsylla cubana
Brite
Translation factors [BR:sehc03012]
 Prokaryotic Type
  Release factors
   A35E_00136
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCRF RF-1
Motif
Other DBs
NCBI-ProteinID: AFP85451
UniProt: J3VTV1
Position
complement(257527..258378)
Genome map
AA seq 283 aa AA seqDB search
MLKIVTHEDDKESLLFINTELDELEAILNKLEYRRMFSGKYDGADCYVDIQAGSGGKDAQ
DWANMLLRMYLRWAVSHKFKVHIIEESEGESVGLKSATIKITGNYAYGWLRTETGVHRLV
RKSPFDSTRRRHTSFSSTFVYPVVEDDIDIDISLGDLRIDVYRASGAGGQHINRTESAVR
ITHLPTNIVTQCQNDRSQHKNKDQAMKQLKAKLYEFELKKKNLEKKVLEDTKSDISWGRH
IRSYILDDSRIKDLRTGIETLKTQSVLDGDLDQFLEASLKLGL
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
ttgttaaaaatagtaactcatgaagatgataaagagagtttactgtttattaacactgaa
ttagatgagttagaagcgatattaaataagctagaatatcggcgtatgttttctggtaaa
tatgatggtgccgattgttatgttgatattcaggctgggtcgggggggaaagacgcacaa
gattgggcaaatatgttgcttagaatgtatttacgatgggcagtatctcataaatttaaa
gttcatattatcgaagaatctgagggggaaagtgtaggccttaaatctgcaacgatcaag
attaccggaaattatgcttatggttggttacggactgaaactggcgttcatcgcctggta
agaaagagtccttttgattctactagacgacgtcatacttcatttagttctacgtttgtt
tatccggttgtagaagatgatattgacatcgatatttctttaggagatctccgtattgat
gtttatcgagcttctggtgcaggagggcaacacattaatcgaactgaatccgcagtacgt
attactcatttacctactaatattgtaacgcaatgtcaaaatgatcgttcgcagcataaa
aacaaagatcaggcaatgaaacaattaaaagctaagttatatgaattcgaattgaagaaa
aaaaatttagaaaaaaaagttttagaagatactaaatctgatattagctggggaaggcat
attcgatcatacatattagatgattcgcgaattaaagatctgcgaactggtatcgaaacg
cttaaaacacaatctgttcttgacggagatttagatcaatttcttgaagcgagtcttaag
ttagggttataa

DBGET integrated database retrieval system