KEGG   Secondary endosymbiont of Heteropsylla cubana: A35E_00137Help
Entry
A35E_00137        CDS       T02336                                 

Definition
(GenBank) tRNA dihydrouridine synthase A
  KO
K05539  
tRNA-dihydrouridine synthase A [EC:1.-.-.-]
Organism
sehc  Secondary endosymbiont of Heteropsylla cubana
Brite
Enzymes [BR:sehc01000]
 1. Oxidoreductases
  1.-  
   1.-.-  
    1.-.-.-  
     A35E_00137
Transfer RNA biogenesis [BR:sehc03016]
 Prokaryotic Type
  tRNA modification factors
   Dihydorouridine synthases
    A35E_00137
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(260231..261265)
Genome map
AA seq 344 aa AA seqDB search
MKKNSVSKYDDFGNLVSSKYSASIQGRFSVAPMLNWTDRHCRFFLRLFSRQALLYTEMLS
ANTLLLSKNDHLVYNNEEHPISLQVGSREPKILARCAKLAEERGYDEINLNVGCPSNRMK
KGFFGAYLMNEKEQVANCVSAMREAVNLPITVKTRIGIDENDSYSFLSEFVDTVSTKGGC
KTFVIHARKAYLNGFSPKKNREIPPLNYERVYKLKQDFPSIRFVLNGGIVNLYDALQHLR
KCDGVMIGREVYRNPSILMKVDSIFFGKLDPVTNRKEIFEKILPYIDNELSQGTSLNHIT
RHMLGLFQGLPGAGHWRRYLSEHAHRPGAGINILVQALSEQLLI
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaaacagtgtatcaaaatacgatgattttggtaacctagtttcatcaaaatat
agtgcatcaatacaagggcgatttagtgttgctcctatgctaaattggactgatcgtcat
tgtcgcttttttttacgattatttagccgtcaagccttgttgtatacagaaatgttaagt
gcgaatactttgttattaagtaaaaatgatcatttagtttataataatgaagaacatcca
atttctttgcaggttggtagtagagagccaaaaatattagcccgttgtgctaaattagca
gaagaaagaggttatgatgaaattaatcttaacgttggctgtccatcaaatcgaatgaaa
aaaggttttttcggcgcctatttaatgaacgaaaaggagcaggttgccaattgtgtttcc
gctatgcgtgaagcagtgaatttgccgattacagtaaaaactcgtattggtattgatgag
aacgatagttattcttttttatctgaatttgttgatacggtttcaacgaaaggtggttgt
aaaacctttgtaattcatgctagaaaagcatatcttaatggttttagtcccaaaaaaaat
agagagattccaccattaaattacgagcgggtttataaattaaaacaagatttcccgtca
attaggtttgtgctaaatggtggaattgtcaacttatacgatgcattacaacacttaaga
aaatgtgatggtgttatgataggtcgcgaagtttatagaaatccttctatattaatgaag
gttgatagtattttttttggaaaacttgatcctgtaacaaatagaaaagaaatttttgaa
aaaatcttgccttatattgataacgaactatctcaaggaacatcattaaatcatataact
cgtcatatgttgggattatttcagggattacctggggctggacattggcgtcggtatttg
agtgagcatgctcatcgtcctggtgcgggaattaatattttagttcaggcattatcagag
cagttattaatctaa

DBGET integrated database retrieval system