KEGG   Secondary endosymbiont of Heteropsylla cubana: A35E_00197Help
Entry
A35E_00197        CDS       T02336                                 

Definition
DNA polymerase III, psi subunit (EC:2.7.7.7)
Orthology
K02344  
DNA polymerase III subunit psi [EC:2.7.7.7]
Organism
sehc  Secondary endosymbiont of Heteropsylla cubana
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:sehc00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    A35E_00197
   00240 Pyrimidine metabolism
    A35E_00197
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    A35E_00197
   03430 Mismatch repair
    A35E_00197
   03440 Homologous recombination
    A35E_00197
Enzymes [BR:sehc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     A35E_00197
DNA replication proteins [BR:sehc03032]
 Prokaryotic Type
  DNA Replication Elongation factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     A35E_00197
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(384844..385272)
Genome map
AA seq 142 aa AA seqDB search
MRTKSITRRNWQLKQLGITQWNLRNPLIFQKPTVVDFFNHNTPFLLISNSSIQKYYPFIC
DVARSMNLNPSQLFEVIPNQVILFPSKLNCYCWWIGIKATKNFLGISFQTDPLEMITQDS
NAKRELWKVITRHKRLIANISD
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atgagaacaaaaagcatcacaagacgtaactggcaattaaaacaactcggcattactcaa
tggaatctccgaaatccattgatatttcagaaaccaactgtcgttgatttctttaatcat
aatactccttttctattaatatctaattcttccatacaaaaatattatccttttatatgc
gatgtagcgcgtagtatgaacttaaacccttcgcaattatttgaagtaataccaaatcaa
gtaatactatttccgagcaaattaaattgctattgttggtggatcgggattaaagccact
aaaaattttttaggaatatcttttcagactgacccattagaaatgattacacaagacagt
aacgcaaaacgagaattatggaaggtaataactcgccataaacgactcattgctaatata
tccgactaa

DBGET integrated database retrieval system