KEGG   Secondary endosymbiont of Heteropsylla cubana: A35E_00243Help
Entry
A35E_00243        CDS       T02336                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
sehc  Secondary endosymbiont of Heteropsylla cubana
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:sehc00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:sehc00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
459832..460320
Genome map
AA seq 162 aa AA seqDB search
MIVGLIAALARDRVIGVKNTIPFNLSADLAWFRCRTLNKPVIMGRKTFESIGSVLPERKN
IVLSDQPDNNSSVTWASFPEQALLEAGKVDAVMVIGGGKVYETFLNWATRLYLTYIDASL
EGDTWFPDYEIHGSWFSTFISYHKKDSKNIYNYCFEILERDL
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgattgttggtttgattgctgcgctagcacgagatcgtgttattggagtaaaaaatact
ataccttttaatctttcagcggatttagcttggtttagatgtagaacgcttaataagccg
gtgattatggggagaaaaacttttgaatctattgggagcgttcttccagaaagaaaaaat
atagtcttaagtgatcaaccagataataatagttcggtaacttgggcttcttttccagaa
caagcattgttagaagcaggtaaggttgatgcagtgatggtgatcggtgggggtaaggtt
tatgaaacgtttcttaattgggctactcgtctttatttgacttatatagatgcttcttta
gagggtgatacttggtttcctgattatgaaattcatggttcatggttttctacttttatt
tcataccataaaaaagattctaaaaacatttataattattgttttgaaattttagagcga
gatctttaa

DBGET integrated database retrieval system