KEGG   Secondary endosymbiont of Heteropsylla cubana: A35E_00243Help
Entry
A35E_00243        CDS       T02336                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
sehc  Secondary endosymbiont of Heteropsylla cubana
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sehc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    A35E_00243
   00670 One carbon pool by folate
    A35E_00243
Enzymes [BR:sehc01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     A35E_00243
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
459832..460320
Genome map
AA seq 162 aa AA seqDB search
MIVGLIAALARDRVIGVKNTIPFNLSADLAWFRCRTLNKPVIMGRKTFESIGSVLPERKN
IVLSDQPDNNSSVTWASFPEQALLEAGKVDAVMVIGGGKVYETFLNWATRLYLTYIDASL
EGDTWFPDYEIHGSWFSTFISYHKKDSKNIYNYCFEILERDL
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgattgttggtttgattgctgcgctagcacgagatcgtgttattggagtaaaaaatact
ataccttttaatctttcagcggatttagcttggtttagatgtagaacgcttaataagccg
gtgattatggggagaaaaacttttgaatctattgggagcgttcttccagaaagaaaaaat
atagtcttaagtgatcaaccagataataatagttcggtaacttgggcttcttttccagaa
caagcattgttagaagcaggtaaggttgatgcagtgatggtgatcggtgggggtaaggtt
tatgaaacgtttcttaattgggctactcgtctttatttgacttatatagatgcttcttta
gagggtgatacttggtttcctgattatgaaattcatggttcatggttttctacttttatt
tcataccataaaaaagattctaaaaacatttataattattgttttgaaattttagagcga
gatctttaa

DBGET integrated database retrieval system