KEGG   Secondary endosymbiont of Heteropsylla cubana: A35E_00359Help
Entry
A35E_00359        CDS       T02336                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
sehc  Secondary endosymbiont of Heteropsylla cubana
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Brite
KEGG Orthology (KO) [BR:sehc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    A35E_00359
   01230 Biosynthesis of amino acids
    A35E_00359
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A35E_00359
   00030 Pentose phosphate pathway
    A35E_00359
   00051 Fructose and mannose metabolism
    A35E_00359
   00052 Galactose metabolism
    A35E_00359
  Energy metabolism
   00680 Methane metabolism
    A35E_00359
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    A35E_00359
Enzymes [BR:sehc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     A35E_00359
Protein phosphatases and associated proteins [BR:sehc01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     A35E_00359
Messenger RNA biogenesis [BR:sehc03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     A35E_00359
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
645548..646510
Genome map
AA seq 320 aa AA seqDB search
MIKKIGILTSGGDSPGMNAAIRGVVRAWLSEGLEVYGIYDGYLGLFQDRMEKLDRYSVSD
MINRGGTFLGSARFPEFKEEKIRLVAIQNMRKRGLDALVVIGGDGSYMGAKRLTEMGFPC
IGLPGTIDNDVAGTDYTIGYFTALETVVEAIDRLRDTSTSHQRISIVEVMGRHCGDLTMA
AAIAGGCEFIILPEEEFKPENLVYEIKAGIAKGKKHAIVAITEHICDVSKLAQYLEQKTG
RETRATVLGHIQRGGSPVAYDRILASRMGAYSIELLLQGYGGRCVGVQNEQLVHHNIVDA
LKKMKRPFRKDILKIAKKLF
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaaaattggtatactgacaagtggtggtgattcaccgggaatgaatgcagct
atccgaggagttgtacgggcatggctatctgaaggtttagaagtttacggcatttacgat
ggctatttaggtctttttcaagatcgtatggaaaaattagatcgttatagtgtctcagat
atgattaaccgtggtggcacttttctcggttctgcgcggtttccagaatttaaagaagaa
aaaattcgacttgttgctattcaaaatatgagaaaacgtggtctagatgcgttggttgtc
attgggggagatggatcttatatgggggctaaacgattgacggaaatgggttttccttgt
attggattgccgggtacaattgataatgatgtagctggtaccgattatactattggttat
ttcactgctttagaaactgtcgttgaagcgatagatcgacttcgtgatacgtctacatca
catcaacgtatttctatagtcgaagttatggggcggcattgtggggacctaacaatggcg
gcagctattgcaggcggatgcgaatttattattttgcctgaagaagaatttaaaccagaa
aacttagtatacgaaattaaggcgggtatcgctaagggtaaaaaacatgctattgttgct
attactgagcatatctgtgatgtttccaaattagcacaatatcttgaacaaaaaacaggg
cgggaaacacgtgcaaccgtattaggtcatatccaacgcggtggtagcccagtcgcttat
gatcgtattttagcatctcgtatgggtgcatattctattgaattgttattacagggttac
ggtggtcggtgtgttggggtgcaaaatgagcaattagtgcatcataatattgttgatgct
ttaaaaaaaatgaaacgtcctttccgtaaagacatcctaaaaatagcaaaaaagcttttt
tga

DBGET integrated database retrieval system