KEGG   Secondary endosymbiont of Heteropsylla cubana: A35E_00400Help
Entry
A35E_00400        CDS       T02336                                 

Definition
UDP-N-acetylmuramyl-tripeptide synthetase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
sehc  Secondary endosymbiont of Heteropsylla cubana
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:sehc00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    A35E_00400
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    A35E_00400
Enzymes [BR:sehc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     A35E_00400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(711386..712876)
Genome map
AA seq 496 aa AA seqDB search
MANYNLRTLLHPWVPCVPKCILKGITLDSRTVIEGYLFIAIIGHKIDARRYIPQAITQGA
IAVLSETESKDKEGEIHELHGVPIIYLYQLKTRLSLLAGRFYKNPSHFLSLVAVTGTNGK
TSTSHLLAQWVQLLGNKTGVMGTIGNGALGNIHPSKNTTESPFEIQKTLSNLKLQGVRFA
AMEVSSHALVQDRVNNVFFSAAVFTNLSRDHLDYHKDMEKYESAKWTLFNKLAVNQHIIN
ADDATGRRWLKTLKKAIAVTLNKSLPIKWKGRWLSAGKVRYHAEGTEIPFRSTWGNGTIQ
SPLVGKINTSNILLALTTLLALGYPLLELVKSTSYLQPVCGRMEVFRIQNRPMVMLDYAH
NPDALKKILIDARLYCEGKLWCIFGCGGERDKGKRPIMGAIAEQYADQVIITDDNPRNEK
ALDIINDIQRGLLDKRKIQVISNRTHAITMAIMQATTSDLVVVAGKGHENYQIIGQHQLY
FSDRILIARLLKGQAK
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
gtggctaattataacttacggacactactccacccttgggtgccttgtgtcccaaaatgt
attttaaaaggaattacactcgatagccgcactgtaattgaagggtatctttttattgct
ataataggccataagatcgatgcacgacggtatattccccaggctattacacaaggtgca
atagccgttttatcggaaaccgaaagcaaagacaaagaaggtgaaatccatgaactacac
ggcgtcccaattatctatctctatcaactcaaaacccgattatcacttttagctggacgc
ttttataaaaatccatcgcactttctttctttggtagcggttactggcactaatggaaaa
acaagtactagtcatcttcttgcccagtgggtacagttattaggcaataagactggcgta
atgggaactatcggtaacggtgcacttggtaacatccatccatctaaaaacactactgag
tctccttttgaaattcaaaaaactttatctaatttaaaactccagggcgtccgtttcgca
gcgatggaagtatcttctcatgccctagttcaagatcgggttaacaatgtatttttttct
gctgcagtatttactaatttaagtcgcgaccaccttgactatcacaaagatatggaaaag
tatgaatccgctaaatggacgttgttcaacaaactagctgtcaatcagcatattattaat
gccgatgatgctaccggaaggcgttggctcaaaacattgaaaaaagcaatcgcagttaca
cttaacaaatcacttccaataaagtggaagggtagatggctatccgctggcaaggtccgt
tatcatgcagaaggaacggaaatcccatttcgatctacctggggaaatggaacaattcaa
agtccactagtaggaaaaataaatacaagtaatattttactagctctcactacccttcta
gcgcttggatatccattactagagctagtaaagagtaccagctatctgcaacctgtctgc
ggtcgcatggaagtctttcgaattcaaaatcgccctatggttatgttagattatgctcat
aacccagatgcacttaaaaaaattttaatagatgcaagattatattgcgaaggtaaatta
tggtgcatatttggctgtggtggagaacgagataaaggtaaaagacctatcatgggggcc
atcgctgaacagtacgcagatcaggtaatcattactgatgataacccacgtaatgaaaaa
gctttagatatcattaatgatattcagcgtggcctgctagataagagaaaaattcaggta
atttctaatcgaacacacgcgatcaccatggccattatgcaagctacaacttcagattta
gtagtagtagccggtaaaggtcatgaaaattaccagattattgggcaacatcaattatat
ttttcagatcgtattcttattgcccgattattgaaaggacaagcaaagtga

DBGET integrated database retrieval system