KEGG   Secondary endosymbiont of Heteropsylla cubana: A35E_00485Help
Entry
A35E_00485        CDS       T02336                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
sehc  Secondary endosymbiont of Heteropsylla cubana
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:sehc00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
859481..860146
Genome map
AA seq 221 aa AA seqDB search
MLTLTKEASQVREALVAAGLESLPQDIALTNIVRQELIAGHMMEIMAILNLDLSDDSLKK
TPHRIAKMYIEEIFLGLNYANFPKITLIENKMQIHEMVTICNITLTSTCEHHFILIDGKA
SVSYIPEYSIIGLSKINRIVHFFSQRPQIQERLTKQILLALQTLLETNNVAVSIDAIHYC
VKGRGICDATSTTTTISCGGLFKSNQNTREEFLRTIKSYCN
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgctaacattgacaaaagaagcatctcaggtacgtgaagctttagtagccgctggtttg
gaatcattaccgcaagatatagcgctcactaatatagtcagacaagaactcattgcagga
catatgatggaaatcatggctatacttaacctcgatttaagtgatgatagtttaaaaaaa
acaccgcaccgtattgctaaaatgtatattgaagaaatttttttaggtttgaattatgct
aattttcccaaaattactcttatcgaaaataagatgcagatacatgaaatggttactata
tgcaatattaccctaaccagcacctgtgaacaccattttattttaattgatggcaaggct
tctgtttcatatataccagaatatagtattattggattatcaaaaataaatcgtatcgta
cattttttttctcaacgacctcaaatacaagaacgactaaccaagcaaatcttactagca
ttgcagaccttacttgaaacaaataatgttgctgtctctatcgatgctatacattattgt
gttaagggacgaggaatatgtgatgccactagcacaacaacaactatttcatgtggtggg
ttatttaaatctaaccaaaatacccgagaagaatttttacgtacgattaaatcgtattgt
aattaa

DBGET integrated database retrieval system