KEGG   Secondary endosymbiont of Heteropsylla cubana: A35E_00542Help
Entry
A35E_00542        CDS       T02336                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
sehc  Secondary endosymbiont of Heteropsylla cubana
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:sehc00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:sehc00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:sehc00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:sehc00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
967335..968240
Genome map
AA seq 301 aa AA seqDB search
MYPTKNKVKKAVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYVVNECVASNLNEIILV
THSSKNSIENHFDTSFELETMLEKRVKRQLLEEIQAICPPHVTIMHIRQGLTKGLGHAIL
CAQPLVGNEPVAIILPDVIINEYASNLKTENLSAMLKRFEDTGCSQILVKPVKDVSNYGV
IDWQGNTINPGESVKILGIIEKPSREETPSNLSVVGRYVLSAHIWEILKTTPPRSGNEIQ
LTDAIAMLICKENVEGYHLIGLRHDCGNKLGYMKAFVEYALCHKTLGKKFKKWITNTALK
Q
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgtatcccactaaaaacaaagtaaaaaaagcagtaattccagtagctggattagggacc
cgcatgttaccagcgacaaaagctattccaaaagaaatgctacccttggtagacaagccc
ctcattcaatatgtagttaatgaatgtgttgcatctaaccttaatgaaattattttagta
acacactcatctaaaaactccattgaaaatcattttgatactagctttgagctagaaact
atgttagaaaaacgtgtcaagcgtcaacttctagaagaaattcaagcaatttgtcctcca
catgttacaattatgcacattcgtcaagggttaaccaagggattaggtcatgcaatattg
tgcgcgcaacctcttgtcggaaacgaaccagttgcaattattttacctgatgtgattatc
aatgaatatgcctcaaatctaaagacagaaaatctatcagcaatgttaaaacgatttgaa
gataccggatgtagtcaaattctagttaaacccgttaaagatgttagtaactatggggtg
attgattggcaaggtaacactatcaacccaggagaaagcgtaaaaatattgggtattatt
gaaaaaccgtctcgagaagaaaccccatcaaatttatcagtagtgggccgctacgtcctt
tctgcgcatatttgggaaatcttgaaaacaacaccaccaagatctggtaatgaaatccaa
ttaaccgatgctattgcaatgctaatatgcaaagaaaatgtagaaggttatcatttaatc
ggacttagacatgattgcggaaacaagttaggttatatgaaagcattcgtagaatatgct
ttgtgtcataaaactcttggaaaaaaatttaaaaaatggataacgaatacagcattaaaa
caataa

DBGET integrated database retrieval system