KEGG   Salmonella enterica subsp. enterica serovar Paratyphi C: SPC_0164Help
Entry
SPC_0164          CDS       T00862                                 

Gene name
aceF
Definition
dihydrolipoamide acetyltransferase
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sei  Salmonella enterica subsp. enterica serovar Paratyphi C
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:sei01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sei00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:sei00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:sei00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
174982..176874
Genome map
AA seq 630 aa AA seqDB search
MAIEIKVPDIGTDEVEITEILVKVGDKVEAEQSLITVEGDKASMEVPSPQAGIVKEIKVS
VGDKTETGALIMIFDSADGAADAAPAKAEEKKEAAPAAAPAAAAAKDVHVPDIGSDEVEV
TEVMVKVGDTVEAEQSLITVEGDKASMEVPAPFAGTVKEIKVNTGDKVSTGSLIMVFEVA
GAAPAAAAPAKAEAAPAAAAPAAATGVKDVNVPDIGGDEVEVTEVMVKVGDKVAAEQSLI
TVEGDKASMEVPAPFAGTVKEIKISTGDKVKTGSLIMVFEVEGAAPAAAPAKQEAAAPAP
AAKAEKPAAPAAKAEGKSEFAENDAYVHATPLIRRLAREFGVNLAKVKGTGRKGRILRED
VQAYVKDAIKRAEAAPAAAGGGIPGMLPWPKVDFSKFGEVEEVELGRIQKISGANLSRNW
VMIPHVTHFDKTDITDLEAFRKQQNAEAEKRKLDVKYTPVVFIMKAVAAALEQMPRFNSS
LSEDGQRLTLKKYINIGVAVDTPNGLVVPVFKDVNKKSVTELSRELTTISKKARDGKLTA
GEMQGGCFTISSIGGLGTTHFAPIVNAPEVAILGVSKSAMEPVWNGKEFVPRLMMPISLS
FDHRVIDGADGARFITIINNMLSDIRRLVM
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgaaatcaaagtaccggacatcgggacagatgaagttgaaatcaccgagatt
ctggtcaaagtgggcgacaaagttgaagctgaacagtcgctgatcaccgtagaaggcgac
aaagcctctatggaagttccgtctcctcaggcaggtatcgttaaagagatcaaagtctct
gttggcgacaaaactgagaccggtgcacttatcatgattttcgattccgccgacggtgca
gctgacgctgcacctgctaaggcagaagagaagaaagaagcggcgccggcagcagcacct
gctgcggcagcggcgaaagacgttcacgttccggatatcggcagtgacgaagttgaagtg
actgaagtgatggtgaaagtgggcgacaccgtagaagctgaacagtcgctgatcaccgtc
gaaggcgacaaggcctctatggaagtgccggcgccgttcgcgggcaccgtgaaagagatc
aaagtgaacaccggtgataaagtgtctaccggctctctgattatggtcttcgaagtggcg
ggcgcagcgcctgccgcagcagcaccagcgaaagcggaagccgctccggctgcggctgct
ccagcagcagcgacgggcgtgaaagacgttaacgtaccggatatcggcggcgacgaagtt
gaagtcaccgaagtgatggtcaaagtcggcgataaagttgccgctgaacagtcgctgatc
accgtggaaggcgacaaagcctccatggaagtgcctgcgccgttcgcgggcaccgtgaaa
gaaatcaaaatcagcaccggcgataaagtgaaaaccggttctctgattatggtcttcgaa
gtagaaggcgcagcgcctgcggccgctccggctaaacaggaagcggcggcgccggctccg
gcggcgaaagctgagaagcctgctgccccggctgccaaagcggaaggcaaatctgagttc
gctgaaaacgacgcttacgttcacgctaccccgctgattcgccgcctggcgcgcgagttt
ggcgtaaacctggcgaaagtgaaaggcaccggtcgtaaaggccgtattctgcgcgaagac
gttcaggcttacgtgaaagacgcaatcaaacgcgcggaagctgcgccggctgctgcgggc
ggtggtatcccgggtatgctgccgtggccgaaagtggacttcagcaagtttggtgaagtt
gaagaagtggaactgggccgtatccagaaaatctctggcgcgaacctgagccgtaactgg
gtgatgatcccgcacgttacgcacttcgacaaaaccgatatcaccgatctggaagcgttc
cgtaaacagcagaacgccgaagctgagaagcgtaaactggatgtgaaatacacgccagtg
gtcttcatcatgaaagcggttgccgctgctctggaacagatgccgcgcttcaacagctcg
ctgtctgaagacggtcagcgtctgaccctgaagaaatacatcaacatcggcgtggcggtt
gatacaccgaatggcctggtggttccggtctttaaagacgtgaataagaagagcgtgacc
gagctgtctcgtgaactgaccaccatctccaaaaaagcgcgtgatggtaagctgaccgct
ggcgaaatgcagggtggttgcttcactatctccagcatcggcggtctgggaactactcac
ttcgcgccgattgttaacgcgccggaagtggctatcctcggcgtttctaagtcggcgatg
gaaccggtgtggaatgggaaagagtttgtgccgcgtctgatgatgcctatctctctttct
ttcgaccaccgtgtgatcgatggtgctgatggtgcgcgtttcattaccattatcaacaat
atgttgtctgacattcgccgtctggtgatgtaa

DBGET integrated database retrieval system