KEGG   Salmonella enterica subsp. enterica serovar Paratyphi C: SPC_0197Help
Entry
SPC_0197          CDS       T00862                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
sei  Salmonella enterica subsp. enterica serovar Paratyphi C
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sei00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SPC_0197 (folK)
Enzymes [BR:sei01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     SPC_0197 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(209823..210302)
Genome map
AA seq 159 aa AA seqDB search
MTIAYIALGSNLASPLEQVNAALKAIADIPDSRIVTVSSFYRTPPLGPQDQPDYLNAAVA
LDTALAPEELLNHTQRIELQQGRVRKAERWGPRTLDLDIMLFGDEVINTDRLTVPHYDMK
NRGFMLWPLFEIAPDLIFPDGISLHQHLTHLGAAKPAHW
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgacgatcgcgtatatcgcgcttggcagtaatctggcctctccgctggagcaggtcaat
gccgccctgaaggctatcgccgacattcccgatagccgtatcgtcacggtgtcttcgttt
taccgcacgccgccgcttggcccacaggatcagcccgattacctgaacgctgcggtggcg
ctggataccgctctcgcccccgaagaattgcttaaccatacccagcgcattgagctgcaa
cagggccgggtgcgcaaagccgaacgctgggggccgcgcacgctggatctcgacattatg
ctgtttggcgatgaagtcattaacaccgaccgtctgaccgtgccgcactacgacatgaaa
aaccgcggttttatgctgtggccgttattcgaaatcgctcctgatctgatctttccggat
ggtatcagcctgcatcagcatctcacccatcttggtgctgcaaaacccgcccactggtaa

DBGET integrated database retrieval system