KEGG   Salmonella enterica subsp. enterica serovar Paratyphi C: SPC_0333Help
Entry
SPC_0333          CDS       T00862                                 

Gene name
proB
Definition
(GenBank) gamma-glutamyl kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
sei  Salmonella enterica subsp. enterica serovar Paratyphi C
Pathway
sei00330  Arginine and proline metabolism
sei00332  Carbapenem biosynthesis
sei01100  Metabolic pathways
sei01130  Biosynthesis of antibiotics
sei01230  Biosynthesis of amino acids
Module
sei_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:sei00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    SPC_0333 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    SPC_0333 (proB)
Enzymes [BR:sei01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     SPC_0333 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: ACN44520
UniProt: C0Q6U1
Position
360754..361893
Genome map
AA seq 379 aa AA seqDB search
MVFISYFERQRIMSDSQTLVVKLGTSVLTGGSRRLNRAHIVELVRQCAQLHAAGHRIVIV
TSGAIAAGREHLGYPELPATIASKQLLAAVGQSRLIQLWEQLFSIYGIHIGQMLLTRADM
EDRERFLNARDTLRALLDNHIVPVINENDAVATAEIKVGDNDNLSALAAILAGADKLLLL
TDQQGLFTADPRSNPQAELIKDVYGVDDALRSIAGDSVSGLGTGGMSTKLQAADVACRAG
IDTIIASGSKPGVIGDVMEGISVGTRFHAQASPLENRKRWIFGAPPAGEITVDEGATAAM
LERGSSLLPKGIKSVTGNFSRGEVIRICNLQGRDIAHGVSRYNSDALRRIAGHHSQQIDA
ILGYEYGPVAVHRDDMITR
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
ttggtctttatttcttattttgaacggcagagaatcatgagtgacagccagacgctggtc
gtaaaactcggcaccagcgtgctaacaggcggatcgcgccgcctgaaccgtgcccatatc
gtagaacttgtccgccagtgcgcgcagctacacgccgcgggacatcgtattgttattgtt
acctctggcgcgattgccgccggacgtgaacatctcggctacccggaactgccggcaaca
attgcctctaaacagcttctggcggcggtagggcaaagccgtctgattcaactgtgggag
cagttgttttcaatttacggtatccatatcgggcagatgctgttgacgcgtgcggatatg
gaagacagagagcgctttctgaacgcccgcgatacgctgcgtgcattactggataaccat
attgtgccggttatcaatgaaaatgatgccgttgcgacagcggaaattaaagtgggcgat
aacgataacctctccgcgctggcggcgatcctggcaggcgcggataaactgctgctgctg
accgatcagcaaggattatttaccgccgatccgcgtagcaatccgcaggcggagcttatc
aaagatgtgtatggcgttgacgatgcgctgcgctctatcgcgggagacagcgtttccggg
ctgggaaccggtggtatgagcactaagcttcaggcggcagacgtggcctgtcgcgcgggt
attgatacgattattgcctcaggcagtaaaccgggcgttatcggcgatgtgatggagggg
atttccgtcggcacccgttttcatgcgcaagcctcgccgctggagaaccgaaaacgttgg
atcttcggcgcgccgccggcaggcgaaattacggttgatgaaggcgcgaccgcggcaatg
ctggaacgtggcagttcacttctgccaaaaggcatcaaaagcgtgacgggcaatttctcg
cggggggaggtcatcagaatttgtaacctgcaagggcgtgatattgctcatggcgtcagc
cgttataacagtgatgctctgcggcggatagccggtcaccactctcaacaaatcgatgcg
attctgggctatgaatatggcccggtcgctgttcatcgtgatgacatgattactcgataa

DBGET integrated database retrieval system