KEGG   Salmonella enterica subsp. enterica serovar Paratyphi C: SPC_0369Help
Entry
SPC_0369          CDS       T00862                                 

Gene name
res
Definition
DNA restriction enzyme
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
sei  Salmonella enterica subsp. enterica serovar Paratyphi C
Brite
Enzymes [BR:sei01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.5  type III site-specific deoxyribonuclease
     SPC_0369 (res)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
399944..402919
Genome map
AA seq 991 aa AA seqDB search
MMMNILLEELPHQEQALAAILASFTGIDHAQADHNHYANPLIKERYDDKANIDVKMETGT
GKTYVYTRLMYELHQKYGLFKFVLVVPTPAIKEGARNFITSDYARQHFSQFYENTRMELC
TINAGDFKVKSGRKNFPAQLLSFTDASRRDSHTIQVLLINAQMLNSASMTRDDYDQTLLG
GLTSPVKGLQMTRPVVIIDEPHRFARDNKFYRAIQAIQPQMIVRFGATFPDIVEGKGKNK
CVRKDYYRRQPQFDLNAVDSFNDGLVKGIDIYYPNLPEEQANNRYIVDSVTAKKLILRRG
SKIAEVGVGENLADVDAGFEGSIEYAGSKMLSNDLELEAGMALVPGTFGASYQELIIQDA
IDKHFDTEQANFLRSNEPENNAPRIKTLSLFFIDSIKSYRDDEGWLKLKFECLLKKKLTQ
LIDDYQRKTLPREVEYLSFLQATLASLHSDNQNVHAGYFGEDRGSGDEAIQAEVDDILKN
KEKLLSFSDHHGNWETRRFLFSKWTLREGWDNPNVFVIAKLRSSGSESSKIQEVGRGLRL
PVDENGHRVHQEEWPSRLSFLIGYDEKAFASMLVDEINRDSKVQLNEQKLDEAMITLIVT
ERQKVDPAFTELHLLEDLDDKKLINRSNEFKPSVTLNRETKSGFAWLLEFYPELTQARVR
ADRIRDNKPASRLRVRLRKENWEQLSSIWEQFSRRYMLQFERSGASLEQIAAEVLRDPSL
YIRQKPSQVQQRLVSNEDNGRFEVAQREGELAASEFMAGMKYGHFLKQLALRTSLPVNVL
HPVLMAMLRDVLHGDSRYLSEISLDNMTRALQTRINAHFAQRHDYLPLDFQASTSVFDST
ARQFREEISAEIVGKNVDENAIDDPRSLYQIPPLRYDSVDPELPLLKYDYPQQVSVFGKL
PKRAIQIPKYTGGSTTPDFVYRIERQDADSVYLLVETKAENMRVGDQVILDAQRKFFDML
RRQNINVEFAEATSAPAVFSTINGLIEGKAN
NT seq 2976 nt NT seq  +upstreamnt  +downstreamnt
atgatgatgaatattttactggaagaacttccccatcaggaacaggcgttagcggcgatt
ctggcgagtttcaccggtatcgatcacgcgcaagccgatcataatcactatgctaatccg
ctgattaaggaacgttacgacgataaggccaatattgacgttaaaatggagaccgggacg
ggtaaaacctatgtctatacccggttgatgtatgaattgcatcagaagtatggcctcttc
aaatttgtgctggtggtgccgacgccagccattaaagaaggcgcgcggaactttattacc
agcgattacgccagacagcatttttcacagttctacgaaaatacgcggatggaactttgc
accatcaacgccggtgattttaaagtaaagtcggggcgtaaaaattttccggcccagcta
ttaagttttactgatgccagccgtcgtgatagccatacgattcaggttttgctgatcaat
gcgcaaatgctcaattccgccagtatgacgcgagacgattacgatcaaacgctactgggc
gggctgacgtcgcctgttaaagggctgcaaatgacgcgaccggtggtcattattgatgaa
ccgcatcgttttgcgcgagataacaaattttatcgagcgattcaggctattcagccgcaa
atgatcgtccgctttggcgctaccttcccggatattgtcgaaggtaagggtaaaaataaa
tgtgtacgtaaagattactatcgccggcaaccgcagtttgatctcaacgcggtggacagt
tttaacgatggtttggtgaaaggtattgatatttattacccgaatctccccgaagaacag
gccaacaatcgttatatcgttgacagcgtcacggcaaagaaattaatcctccgacggggg
agcaaaattgccgaggttggcgtgggcgaaaatctcgccgatgtcgatgcaggatttgaa
ggcagtattgaatatgccggcagtaaaatgttgtcgaacgatctggagctggaggcaggg
atggcgctggtgccaggaacctttggcgcgagctaccaggaactgattattcaggacgcc
attgataagcattttgataccgagcaggcaaatttcttacgcagcaatgagccagaaaat
aatgccccgcgtattaagaccttaagccttttctttattgacagtattaaaagctatcgt
gatgacgaaggttggttgaaactgaagtttgagtgtttactgaaaaagaaactgacgcaa
ctgattgacgattatcagcgcaagaccctgccgcgagaagtggagtatctgtcgtttctg
caggccacgctcgccagcctgcactcggataaccaaaacgtccacgctggttactttggc
gaagaccgcggaagcggcgatgaggcgatccaggctgaggtagatgatattctgaaaaat
aaagagaagttgctcagtttttcagaccatcacggcaactgggaaacgcgccgctttctg
ttttcaaaatggacgcttcgcgaaggctgggataacccgaatgtttttgtcattgctaaa
ttacgttcttccggtagcgagtcgagcaaaattcaggaagtggggcgcggcctgcggcta
ccggtagatgaaaacggccatcgcgttcatcaggaagagtggccgtcccgactgtcgttt
ctgattggttatgatgaaaaagcgtttgccagtatgctggttgatgagattaatcgcgac
agcaaagttcagcttaacgagcagaagctggatgaggcgatgatcacactcatcgtcacc
gagcgacaaaaagtcgatcctgcgtttacggagcttcatttgctggaagatctggatgat
aaaaaactgatcaaccggagtaatgagtttaaacccagcgtcacgcttaacagggaaacc
aaaagtggctttgcgtggctactggagttctaccctgagctgacgcaggcgcgggtgcga
gcggatcgcattcgtgacaataagcccgcctcccgactgcgagtcaggttacgcaaagag
aattgggaacaacttagcagtatctgggagcagttttcccgccgttatatgctgcaattc
gagcgtagcggcgcttctctggaacagattgccgccgaggtgctgcgcgatccgtcgctg
tatatacgccagaagccaagccaggtgcaacaacggctggtatcgaatgaagataatggc
cgttttgaagtggcgcagcgggaaggcgaattagccgccagcgaatttatggcgggcatg
aaatatggccattttcttaagcaactggcgttacgcaccagtctgccggttaacgtcctg
cacccggtgttaatggcgatgctgcgtgatgttttgcacggagattcacgctatttaagc
gagatctcgttggacaatatgacccgcgcattacagacgcggattaatgcgcattttgcg
cagcgccacgattatctgcctctcgacttccaggcttcaacgtcggtatttgattccacg
gcacggcagttcagagaggagattagcgctgaaattgtggggaaaaatgtggatgagaat
gcgatagacgatcctcgttctctctatcaaataccgccgttgcgttatgacagcgtcgat
ccagaattgccgctattaaaatacgattatccgcaacaggtttctgtgtttggcaaactg
cctaagcgggccattcagatccccaaatatacgggaggctctactacgccggattttgtg
taccgtattgagcgtcaggacgccgacagcgtttatttactggttgaaactaaagcagaa
aatatgcgcgtaggcgatcaggttattcttgatgcgcaacgtaaattcttcgatatgctg
cgtcggcaaaatattaatgtcgagtttgcggaagcgaccagcgcgccggcggtattttct
acgatcaatggcttgattgaggggaaggcaaactaa

DBGET integrated database retrieval system