KEGG   Salmonella enterica subsp. enterica serovar Paratyphi C: SPC_0730Help
Entry
SPC_0730          CDS       T00862                                 

Gene name
sdhD
Definition
succinate dehydrogenase cytochrome b556 small membrane subunit
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
sei  Salmonella enterica subsp. enterica serovar Paratyphi C
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:sei00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SPC_0730 (sdhD)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SPC_0730 (sdhD)
   00650 Butanoate metabolism
    SPC_0730 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    SPC_0730 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
776421..776768
Genome map
AA seq 115 aa AA seqDB search
MVSNASALGRNGVHDFILVRATAIVLTLYIIYMVGFFATSGELTFEAWTGFFSSAFTKVF
TLLALFSILIHAWIGMWQVLTDYVKPLAVRLILQLVIVVALVVYVIYGFVVVWGV
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaagcaacgcctccgcattaggacgcaatggcgtacatgacttcatcctggtccgt
gctaccgctatcgttctgacgttatacatcatctacatggtgggttttttcgccacgagc
ggcgaactgacctttgaagcctggaccggtttcttctcatcggccttcaccaaagtcttc
accctgctggcgcttttttccatcttgattcatgcctggatcggcatgtggcaggtgtta
accgactacgttaaaccactggcagtgcgtctgatactgcaactcgttattgttgttgcg
ctggtggtttacgtcatctatggatttgttgtggtgtggggtgtgtaa

DBGET integrated database retrieval system