KEGG   Salmonella enterica subsp. enterica serovar Paratyphi C: SPC_1031Help
Entry
SPC_1031          CDS       T00862                                 

Definition
lysozyme
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
sei  Salmonella enterica subsp. enterica serovar Paratyphi C
Brite
Enzymes [BR:sei01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     SPC_1031
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1079830..1080294
Genome map
AA seq 154 aa AA seqDB search
MQGLMMRISEKGITLIKEFEGCSLTAYPDPGTGGDPWTIGYGWTHSVDGKPVKPGMMIDE
ATAERLLNTGLVGYENDVSRLVKVKLTQGQFDALVSFAYNLGARTLSSSTLLRKLNAGDY
AGAADEFLRWNKAGGKVLNGLTRRREAERALFLS
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
gtgcaggggttaatgatgagaatcagtgaaaaaggcattaccctaatcaaagagtttgaa
ggttgtagcctgacagcttatccggacccgggaacggggggagatccctggacgattggt
tatggctggacccactctgttgacggtaagccagttaagcccggaatgatgattgacgag
gctactgccgagcgcttgcttaacactggtttagtcggttatgaaaatgatgtgtccaga
ctggttaaggtcaagttgacgcaaggccagtttgatgcgctggtgtcgttcgcgtacaac
ctcggcgcccggacattatcctcatcaactctgctgcggaagctaaacgctggtgattac
gctggcgccgctgatgagttcctgcgctggaataaggctggtggcaaagtactgaacggg
cttacccgtcggcgtgaggcggagcgtgctctgttcctgtcatga

DBGET integrated database retrieval system