KEGG   Salmonella enterica subsp. enterica serovar Paratyphi C: SPC_1252Help
Entry
SPC_1252          CDS       T00862                                 

Gene name
glk
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
sei  Salmonella enterica subsp. enterica serovar Paratyphi C
Pathway
sei00010  Glycolysis / Gluconeogenesis
sei00052  Galactose metabolism
sei00500  Starch and sucrose metabolism
sei00520  Amino sugar and nucleotide sugar metabolism
sei00521  Streptomycin biosynthesis
sei01100  Metabolic pathways
sei01110  Biosynthesis of secondary metabolites
sei01120  Microbial metabolism in diverse environments
sei01130  Biosynthesis of antibiotics
sei01200  Carbon metabolism
Module
sei_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sei_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sei00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPC_1252 (glk)
   00052 Galactose metabolism
    SPC_1252 (glk)
   00500 Starch and sucrose metabolism
    SPC_1252 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    SPC_1252 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SPC_1252 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    SPC_1252 (glk)
Enzymes [BR:sei01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SPC_1252 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase PaaX_C
Motif
Other DBs
NCBI-ProteinID: ACN45416
UniProt: C0PZD3
Position
1320324..1321289
Genome map
AA seq 321 aa AA seqDB search
MTKYALVGDVGGTNARLALCDIASGEISQAKTYSGLDYPSLEAVVRVYLDEHSVSVEDGC
IAIACPITGDWVAMTNHTWAFSIAEMKKNLGFSHLEIINDFTAVSMAIPMLKKEHLIQFG
GGEPVDGKPIAVYGAGTGLGVAHLVHVDKRWISLPGEGGHVDFAPNSEEEAMILEILRAE
IGHVSAERVLSGPGLVNLYRAIVKSDNRLPENLRPKDITERALADNCIDCRRALSLFCVI
MGRFGGDLALTMGTFGGVYIAGGIVPRFLEFFKASGFRGGFEDKGRFKDYVHGIPVYLIV
HDNPGLLGSGAHLRQTLGHIL
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagtatgctttagtaggagatgtaggcggcacgaatgcgcgtcttgctctgtgt
gatatcgccagtggagaaatctcgcaggccaaaacgtattccggcctggattatcccagt
cttgaggccgtggtgcgcgtttatctcgatgagcatagcgtcagcgtggaagatggttgt
atcgccatagcctgcccgattaccggtgactgggtagcgatgactaaccatacctgggct
ttttctattgcggaaatgaaaaaaaatctcggctttagccatctggaaatcatcaacgat
ttcaccgccgtgtcgatggcgatcccgatgctgaaaaaagagcatttaattcagttcggc
ggcggcgaaccggtagacggcaaacctattgcggtgtatggcgcgggaaccggcttgggc
gtggcgcatctggtgcatgtggataagcgttggattagccttccgggcgaaggcgggcat
gtcgattttgcgcctaatagcgaagaagaagctatgattctggaaatattgcgcgccgaa
attggccacgtttccgccgagcgcgtgctgtctggcccggggctggtgaatctttaccgg
gcgattgttaagtccgacaaccgtttgccggagaatctgcgcccgaaagatattaccgaa
cgcgccctggcggataactgtatcgattgtcgccgcgcgttgtcgctcttttgcgtcatc
atggggcgatttggcggcgatctggcgttaaccatggggacatttggcggcgtttatatc
gctggcggtattgtcccgcgcttcctggaattttttaaagcgtctggcttccgtgggggc
tttgaagataaaggccgctttaaagattatgtacacggtattccggtctatctgattgtc
catgataaccccggcttgttaggctccggcgcgcatctgcgccagacattaggtcatatt
ctataa

DBGET integrated database retrieval system