KEGG   Salmonella enterica subsp. enterica serovar Paratyphi C: SPC_1623Help
Entry
SPC_1623          CDS       T00862                                 

Gene name
galF
Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
sei  Salmonella enterica subsp. enterica serovar Paratyphi C
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sei00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SPC_1623 (galF)
   00052 Galactose metabolism
    SPC_1623 (galF)
   00500 Starch and sucrose metabolism
    SPC_1623 (galF)
   00520 Amino sugar and nucleotide sugar metabolism
    SPC_1623 (galF)
Enzymes [BR:sei01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SPC_1623 (galF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1700730..1701752
Genome map
AA seq 340 aa AA seqDB search
MLWCRLRRNVKRAIIIPGSRVIHAGENKLKSYNSATILQVEETMMNLKAVIPVAGLGMHM
LPATKAIPKEMLPIVDKPMIQYIVDEIVAAGIKEIVLVTHASKNAVENHFDTSYELESLL
EQRVKRQLLAEVQSICPPGVTIMNVRQAQPLGLGHSILCARPVVGDNPFIVVLPDIIIDD
ATADPLRYNLAAMVARFNETGRSQVLAKRMKGDLSEYSVIQTKEPLDNEGKVSRIVEFIE
KPDQPQTLDSDLMAVGRYVLSADIWAELERTEPGAWGRIQLTDAIAELAKKQSVDAMLMT
GDSYDCGKKMGYMQAFVKYGLRNLKEGAKFRKSIEQLLHE
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgttatggtgccgactaagacgtaatgtaaagcgtgccatcattatccctggcagcaga
gtaattcatgctggcgaaaacaagctaaagagctataattcagcaaccattttacaggtg
gaagaaacaatgatgaatttgaaagcagttataccggtagcgggtttgggtatgcatatg
ttgcctgccaccaaggcaatcccaaaagagatgctaccgatcgtcgacaagccaatgatt
cagtacattgtcgatgagattgtggctgcagggatcaaagaaatcgtactggtgactcac
gcgtctaaaaacgccgttgagaaccacttcgacacctcttatgaacttgaatcacttctt
gaacagcgcgttaagcgtcagcttttggcggaagtgcaatctatctgcccaccgggcgtg
acgattatgaacgttcgccaggcgcagccgttaggactggggcattctattctgtgcgcg
cgtccggtcgtgggcgataaccctttcattgtggtactcccggatattattattgatgat
gctaccgccgatccgctgcgctataaccttgcggcgatggtggcgcgtttcaatgaaacg
ggtcgcagccaggtgctggcgaagcgcatgaaaggtgatttatcggagtattccgttatc
cagacgaaagaacctctggataatgaaggcaaagtcagccggattgtggagtttatcgaa
aaaccggatcagccgcagacgctggattccgatttgatggcggtaggccgttatgtgctt
tcagccgacatctgggcggaactggaaagaaccgaaccgggcgcctggggccgcatccag
ctcaccgatgccattgctgagctggcgaaaaaacagtcggttgacgcgatgctaatgacg
ggtgacagctatgactgcggtaaaaaaatgggctacatgcaggcatttgtgaagtacggg
ctgcgcaacctgaaagaaggagcgaagttccgtaagagcatagagcagcttctgcatgaa
taa

DBGET integrated database retrieval system