KEGG   Salmonella enterica subsp. enterica serovar Paratyphi C: SPC_1640Help
Entry
SPC_1640          CDS       T00862                                 

Gene name
hisD
Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
sei  Salmonella enterica subsp. enterica serovar Paratyphi C
Pathway
sei00340  Histidine metabolism
sei01100  Metabolic pathways
sei01110  Biosynthesis of secondary metabolites
sei01230  Biosynthesis of amino acids
Module
sei_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:sei00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    SPC_1640 (hisD)
Enzymes [BR:sei01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     SPC_1640 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: ACN45788
UniProt: C0Q1K2
Position
complement(1719989..1721293)
Genome map
AA seq 434 aa AA seqDB search
MSFNTLINWNSCSPEQQRALLTRPAISASDSITRTVSDILDNVKTRGDDALREYSAKFDK
TEVTALRVTPEEIAAAGARLSDELKQAMAAAVKNIETFHSAQTLPPVDVETQPGVRCQQV
TRPVASVGLYIPGGSAPLFSTVLMLATPARIAGCQNVVLCSPPPIADEILYAAQLCGVQE
IFNVGGAQAIAALAFGSESVPKVDKIFGPGNAFVTEAKRQVSQRLDGAAIDMPAGPSEVL
VIADSGATPDFVASDLLSQAEHGPDSQVILLTPDADIARKVAEAVERQLAELPRADTARQ
ALSASRLIVTKDLAQCVAISNQYGPEHLIIQTRNARDLVDAITSAGSVFLGDWSPESAGD
YASGTNHVLPTYGYTATCSSLGLADFQKRMTVQELSKAGFSALASTIETLAAAERLTAHK
NAVTLRVNALKEQA
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgagcttcaataccctgattaactggaacagctgtagccctgaacagcagcgtgcgctg
ctgacgcgtccggcgatttccgcctctgacagtattacccggacggtcagcgatattctg
gataatgtaaaaacgcgcggtgacgatgccctgcgtgaatacagcgctaaatttgataaa
acagaagtgacagcgctacgcgtcacccctgaagagatcgccgccgccggcgcgcgtctg
agcgacgaattaaaacaggcgatggccgctgccgtcaaaaatattgaaacgttccattcc
gcgcagacgctaccgcctgtagatgtggaaacccagccaggcgtacgttgtcagcaggtt
acgcgtcccgtcgcgtctgtcggtctttatattcccggcggctcggctccgctcttctca
acggtgctgatgctggcaacgccggcgcgcattgcgggatgtcagaacgtggttctgtgc
tcgccgccgcccatcgctgatgaaatcctctatgcggcacaactgtgtggcgtgcaggaa
atctttaacgtcggcggcgcgcaggcgattgccgctctggccttcggcagcgagtccgta
ccgaaagtggataaaatttttggccccggcaacgcctttgtaaccgaagccaaacgtcag
gtcagccagcgtctcgacggcgcggctatcgatatgccagccgggccgtctgaagtactg
gtgatcgcagacagcggcgcaacaccggatttcgtcgcttctgacctgctctcccaggct
gagcacggcccggattcccaggtgatcctgctgacgcctgatgctgacattgcccgcaag
gtggcggaggcggtagaacgtcaactggcggaactgccgcgcgcggacaccgcccggcag
gccctgagcgccagtcgtctgattgtgaccaaagatttagcgcagtgcgtcgccatctct
aatcagtatgggccggaacacttaatcatccagacgcgcaatgcgcgcgatttggtggat
gcgattaccagcgcaggctcggtatttctcggcgactggtcgccggaatccgccggtgat
tacgcttccggaaccaaccatgtcttaccgacctatggctatactgctacctgttccagc
cttgggttagcggatttccagaaacggatgaccgttcaggaactgtcgaaagcgggcttt
tccgctctggcatcaaccattgaaacattggcggcggcagaacgtctgaccgcccataaa
aatgccgtgaccctgcgcgtaaacgccctcaaggagcaagcatga

DBGET integrated database retrieval system