KEGG   Salmonella enterica subsp. enterica serovar Paratyphi C: SPC_1761Help
Entry
SPC_1761          CDS       T00862                                 

Gene name
yedO
Definition
D-cysteine desulfhydrase
Orthology
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
sei  Salmonella enterica subsp. enterica serovar Paratyphi C
Pathway
Cysteine and methionine metabolism
Brite
KEGG Orthology (KO) [BR:sei00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    SPC_1761 (yedO)
Enzymes [BR:sei01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.15  D-cysteine desulfhydrase
     SPC_1761 (yedO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1827183..1828169
Genome map
AA seq 328 aa AA seqDB search
MPLHHLTRFPRLELIGAPTPLEYLPRLSDYLGREIYIKRDDVTPIAMGGNKLRKLEFLVA
DALREGADTLITAGAIQSNHVRQTVAVAAKLGLHCVALLENPIGTTAENYLTNGNRLLLD
LFNTQIEMCDALTDPDAQLQTLATRIEAQGFRPYVIPVGGSSALGAMGYVESALEIAQQC
AEVVGLSSVVVASGSAGTHAGLAVGLEHLMPDVELIGVTVSRSVAEQKPRVISLQQAIAG
QLALTATADIHLWDDYFAPGYGVPNDAGMEAVKLLASLEGVLLDPVYTGKAMAGLIDGIS
QKRFNDDGPILFIHTGGAPALFAYHPHV
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgccactacatcacttaacgcgctttcctcgcctggagcttattggcgcgccgaccccg
ctcgaatacctgccgcgattgtctgattatcttggccgtgagatttacattaagcgcgat
gacgttacgcccattgcaatgggcggcaataaactgcgtaagctggagtttctggtggcc
gacgcgctgcgagaaggggcggatacgctgataaccgcaggggcgattcagtcgaaccat
gtccgtcagacggtggcagtcgcggccaaattggggctgcattgcgtcgccttgctggaa
aatccaatcggtaccactgcggaaaattacctgacgaatggtaatcgcctgttactggat
ttatttaatacacaaattgagatgtgcgatgcgctgaccgatccggatgcgcagctgcaa
acgctggcgacgcgcattgaagcgcaagggttcaggccctatgtgatcccggtcggcggc
tccagcgcgctgggcgcaatgggatacgtagagagcgccctggaaatcgcccagcagtgt
gcagaggtcgtcgggctctcttcggtggtggtggcctccggcagcgccggaacgcacgcc
gggttagctgtcgggctggaacatctgatgccggatgtcgaactgattggcgtgactgtt
tcacgttctgtcgccgagcagaaacccagagtgatttccttgcagcaggctattgccggt
cagctggcgctgacggcgacggcggatattcatttatgggatgactattttgccccgggt
tacggcgtgccaaatgacgcggggatggaggcggtgaaactgctggcgagcctggagggg
gtgttgctggatccggtatataccggcaaagcgatggcgggtctgatagacggcatcagc
cagaaacgctttaacgatgacgggccgattctctttattcacaccggtggggcgcctgcg
ctgtttgcctaccatcctcatgtataa

DBGET integrated database retrieval system