KEGG   Salmonella enterica subsp. enterica serovar Paratyphi C: SPC_1819Help
Entry
SPC_1819          CDS       T00862                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
sei  Salmonella enterica subsp. enterica serovar Paratyphi C
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:sei03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1879468..1880079
Genome map
AA seq 203 aa AA seqDB search
MIGRLRGIILEKQPPIVLLETGGVGYEVHMPMTCFYELPEAGQEAIVFTHFVVREDAQLL
YGFNNKQERTLFKELIKTNGVGPKLALAILSGMSAQQFVNAVEREELGALVKLPGIGKKT
AERLIVEMKDRFKGLHGDLFTPAVDLVLTSPASPTSEDAEQEAVAALVALGYKPQEASRM
VNKIARPDASSETLIRDALRAAL
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
gtgataggcagactcagaggcattattctcgaaaaacaacccccgatcgtgctgctggag
acagggggcgtaggctatgaagtacatatgcctatgacctgcttttacgagctgccggag
gccgggcaggaggcaatcgtcttcacccactttgtggtgcgtgaagatgcgcagttgctg
tacggattcaacaataagcaagagcgcacgctgtttaaagagctaattaaaacgaatggc
gtcgggcctaagctggcgctggcgattctctccggcatgtcggcgcagcagtttgtgaat
gcggttgagcgcgaagagcttggcgcactggtgaagctgccgggtatcggcaagaaaacc
gccgaaaggctgattgtcgaaatgaaagaccgctttaaagggctacatggcgatctcttt
acgccagcggtcgatctggtattgacatcgccggccagcccaacctcggaagatgcagaa
caagaagcagttgctgcgctggtggcgctgggttataaaccgcaagaagccagtcggatg
gtaaacaagatcgcccgtccggatgcaagcagtgaaacactgattcgcgacgcgttacgc
gccgcgttatga

DBGET integrated database retrieval system