KEGG   Salmonella enterica subsp. enterica serovar Paratyphi C: SPC_2171Help
Entry
SPC_2171          CDS       T00862                                 

Gene name
adhP
Definition
(GenBank) alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
sei  Salmonella enterica subsp. enterica serovar Paratyphi C
Pathway
sei00010  Glycolysis / Gluconeogenesis
sei00071  Fatty acid degradation
sei00350  Tyrosine metabolism
sei00625  Chloroalkane and chloroalkene degradation
sei00626  Naphthalene degradation
sei01100  Metabolic pathways
sei01110  Biosynthesis of secondary metabolites
sei01120  Microbial metabolism in diverse environments
sei01130  Biosynthesis of antibiotics
sei01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sei00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPC_2171 (adhP)
  Lipid metabolism
   00071 Fatty acid degradation
    SPC_2171 (adhP)
  Amino acid metabolism
   00350 Tyrosine metabolism
    SPC_2171 (adhP)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SPC_2171 (adhP)
   00626 Naphthalene degradation
    SPC_2171 (adhP)
Enzymes [BR:sei01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SPC_2171 (adhP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 CoA_binding Methyltransf_25 2-Hacid_dh_C SCP2
Motif
Other DBs
NCBI-ProteinID: ACN46296
UniProt: C0Q4R3
Position
complement(2229502..2230512)
Genome map
AA seq 336 aa AA seqDB search
MKAAVVTQDHQVDVTEKTLRPLRHGEALLKMECCGVCHTDLHVKNGDFGDKTGVILGHEG
IGVVAEVGPGVTSLKPGDRASVAWFYEGCGHCEYCNTGNETLCCNVKNAGYTVDGGMAEE
CIVVADYAVKVPEGLDSAAASSITCAGVTTYKAVKISHIKPGQWIAIYGLGGLGNLALQY
AKNVFNAKVIAIDVNDGQLKLAEEMGADLTINSRTEDAAKIVQEKTGGAHAAVVTAVAKA
AFNSAVDAVRAGGRVVAVGLPPEAMNLDIPRLVLDGIQVVGSLVGTRQDLTEAFQFAAEG
KVVPKVALRPLEDINVIFKEMEQGQIRGRMVIDFRR
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgctgttgtcacacaagatcatcaggttgatgttactgagaaaacgctgcgt
ccccttcgccacggtgaagctttgctaaaaatggagtgctgcggcgtatgccataccgat
ctacacgtgaaaaacggcgatttcggtgacaaaaccggcgtcattctgggacacgaaggc
attggcgtcgtggcggaagtcggtcccggtgtcacctcgctgaaacccggcgatcgcgcg
agtgtcgcgtggttttatgaaggatgcggacactgtgagtattgcaatacgggcaatgaa
accttatgctgcaacgtgaaaaatgccggttacacggtagatggcggcatggccgaagag
tgtattgtcgtcgcggattatgcggtgaaagtaccggaaggtctggactctgcagcggca
agtagtattacctgcgcgggcgttaccacctataaagcggtgaagatttctcatattaaa
cctggccagtggattgccatctacggtctgggcggtctgggtaatctggccttgcagtac
gcgaaaaacgttttcaatgcgaaagtgatcgccattgatgtcaatgatggacaactgaaa
ctggccgaggaaatgggcgcagatctgaccattaattcacgtacggaagatgcggctaaa
attgtgcaggaaaaaaccggtggcgcgcacgcagcggtggttaccgcggtcgctaaggcg
gcgtttaattccgcagtagatgccgttcgcgccggaggccgcgtggtggcagtcgggttg
ccgccagaagccatgaaccttgatatccctcgcctggtgctggatggcattcaggttgtc
ggttcgttggtggggacacgccaggatctgaccgaagccttccagttcgcggcggaagga
aaagtcgtgccaaaagtcgctttacgtccgcttgaagatatcaacgttatttttaaagag
atggaacagggacaaattcgtggccgtatggtcatcgatttccgccgttaa

DBGET integrated database retrieval system