KEGG   Salmonella enterica subsp. enterica serovar Paratyphi C: SPC_2390Help
Entry
SPC_2390          CDS       T00862                                 

Gene name
btuE
Definition
(GenBank) putative glutathione peroxidase/vitamin B12 transport periplasmic protein BtuE
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
sei  Salmonella enterica subsp. enterica serovar Paratyphi C
Pathway
sei00480  Glutathione metabolism
sei00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:sei00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    SPC_2390 (btuE)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    SPC_2390 (btuE)
Enzymes [BR:sei01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     SPC_2390 (btuE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx Redoxin
Motif
Other DBs
NCBI-ProteinID: ACN46504
UniProt: C0Q638
Position
complement(2446601..2447152)
Genome map
AA seq 183 aa AA seqDB search
MQNSLLNTHVTTIDGEVTTLEKYAGKVLLIVNVASRCGLTPQYEQLENIQKAWADQGFVV
LGFPCNQFMGQEPGSEEEIKTYCASTWGVTFPMFSKIDVNGDARHPLYQKLIAAAPTAVA
PEKSGFYERMVSKGRTPLYPDDILWNFEKFLVGRDGQVVQRFSPDMTPEDPIVMESIKIA
LAK
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaactcgcttcttaatactcacgttacgacgattgatggagaggtcactacactt
gaaaaatacgccggaaaagtgctgctcattgtaaacgtcgcctccagatgtggcctgacg
ccgcaatatgaacagttggaaaatatccagaaggcgtgggcagatcaggggtttgtcgtg
ttgggttttccctgcaaccagtttatggggcaggagccaggcagcgaagaggagattaaa
acctattgtgccagcacctggggcgtcacgttcccgatgttcagtaaaattgatgtgaat
ggcgacgcgcgccatccgctgtatcaaaaactgatagccgctgcgccaacggcagtcgcg
ccggagaagagcggcttttacgaacggatggtaagcaaagggcgtacgccactctatccg
gatgatattctgtggaattttgaaaaatttttggtaggccgggatggtcaggtggtacag
cgtttttcgccggatatgacgcctgaagatcctattgtgatggaaagcataaaaatcgcg
ttggcaaaataa

DBGET integrated database retrieval system