KEGG   Salmonella enterica subsp. enterica serovar Paratyphi C: SPC_2439Help
Entry
SPC_2439          CDS       T00862                                 

Gene name
pncA
Definition
nicotinamidase/pyrazinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
sei  Salmonella enterica subsp. enterica serovar Paratyphi C
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:sei00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2493215..2493871
Genome map
AA seq 218 aa AA seqDB search
MTNRALLLVDLQNDFCAGGALAVAEGDSTIDIANALIDWCQPRQIPVLASQDWHPAQHGS
FASQHQAEPYSQGELDGLPQTLWPDHCVQHTDGAALHPLLNQHAIDACIYKGENPLIDSY
SAFFDNEHRQKTTLDTWLREHDVTELIVMGLATDYCVKFTVLDALELGYAVNVITDGCRG
VNIHPQDSAHAFMEMAAAGATLYTLADWEETQGQAVAR
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaccgggccttattactggtcgacttgcaaaatgacttttgcgccggcggcgcg
ctggctgtagcggaaggcgacagcaccatcgacatcgccaacgctcttattgactggtgc
cagccccggcagattccggtgctggccagccaggactggcatcccgcgcagcatggcagc
ttcgccagccagcatcaggcggaaccctatagtcagggagagctggacgggctgccgcaa
acgctctggccggatcactgcgttcaacataccgacggcgcggcgttacatcccctgctt
aaccaacatgcgattgacgcctgcatctataagggtgagaacccgctgattgatagctac
agcgcgttttttgacaacgaacatcggcagaaaactactcttgatacctggcttcgcgag
catgacgttaccgagcttatcgtgatggggttggcgaccgattactgcgtaaaatttacg
gtgctggatgcgctagagttgggctatgccgttaacgttatcaccgatggctgtcgcggc
gtgaatattcacccgcaggatagcgcacacgcgtttatggaaatggcggcggcaggcgcg
acgctgtatacgctggcagactgggaagagacgcagggccaggctgtcgccaggtag

DBGET integrated database retrieval system