KEGG   Salmonella enterica subsp. enterica serovar Paratyphi C: SPC_2537Help
Entry
SPC_2537          CDS       T00862                                 

Gene name
nagZ
Definition
beta-hexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
sei  Salmonella enterica subsp. enterica serovar Paratyphi C
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sei00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SPC_2537 (nagZ)
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    SPC_2537 (nagZ)
Enzymes [BR:sei01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     SPC_2537 (nagZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(2580709..2581722)
Genome map
AA seq 337 aa AA seqDB search
MLNVEGCELDAEEREILAHPLVGGLILFTRNYHDPEQLRELVRQIRAASRNHLVVAVDQE
GGRVQRFREGFTRLPAAQSFFALHGLEEGGRLAQEAGWLMASEMIAMDIDISFAPVLDVG
HISAAIGERSYHADPAKALAMATRFIDGMHDAGMKTTGKHFPGHGAVTADSHKETPCDPR
PETDIRGKDMSVFRTLISENKLDAIMPAHVIYRAIDPRPASGSPYWLKTVLRQELGFDGV
IFSDDLSMEGAAIMGSYAERAQASLDAGCDMILVCNNRKGAVSVLDNLSPIKAERVTRLY
HKGSFSRRELMDSARWKTASAQLNQLHERWQEEKAGH
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgttgaatgtcgaaggatgtgagctggatgcggaggagcgcgagatactggcgcatccg
ctggttggcgggcttattctgttcacgcgtaattaccatgacccggaacagctgcgcgaa
ttagtgcgccagattcgggcggcatcgcgtaaccatctggtggtggccgtcgatcaggaa
ggcgggcgcgtacagcgtttccgtgaagggtttacccgcctgcccgcggcgcaatctttt
tttgcgctgcatgggctggaagaggggggacgactggcgcaggaggcagggtggctgatg
gccagcgaaatgatcgcgatggatattgatatcagttttgcgccagtgctggacgtcggg
catatcagcgcggcaattggcgagcgttcttatcatgccgatcccgcaaaagcgttggca
atggcaacacgctttattgacggtatgcatgacgccgggatgaaaacgaccggtaagcat
ttccccggccacggcgcggtcacggcggactcccacaaagagacgccgtgcgatccacgt
cctgaaacggacatccgtggcaaagatatgtcggtgttccgcacgctgattagcgagaat
aaactggatgcgattatgcctgcccacgtgatctaccgcgctatcgatccgcgtccggca
agcggttcgccgtactggctgaaaacggtgctgcgtcaggagctaggctttgacggcgtc
attttctccgacgatctgtctatggagggcgcggcgattatgggcagctatgctgagcgc
gctcaggcgtcgctggatgcgggttgcgatatgattctggtctgcaataatcgtaaaggc
gcagtcagcgtgctggataatctgtcgccgatcaaagcagagcgtgttacacgtttgtat
cataaaggttcattttcacgccgggagctcatggactcagcacgctggaaaacagccagc
gcccagctcaaccagttacatgaacgctggcaggaagaaaaagcaggtcattaa

DBGET integrated database retrieval system