KEGG   Salmonella enterica subsp. enterica serovar Paratyphi C: SPC_2554Help
Entry
SPC_2554          CDS       T00862                                 

Gene name
fabD
Definition
ACP S-malonyltransferase
Orthology
K00645  
[acyl-carrier-protein] S-malonyltransferase [EC:2.3.1.39]
Organism
sei  Salmonella enterica subsp. enterica serovar Paratyphi C
Pathway
Fatty acid biosynthesis
Metabolic pathways
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:sei00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    SPC_2554 (fabD)
  Lipid metabolism
   00061 Fatty acid biosynthesis
    SPC_2554 (fabD)
Enzymes [BR:sei01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.39  [acyl-carrier-protein] S-malonyltransferase
     SPC_2554 (fabD)
Lipid biosynthesis proteins [BR:sei01004]
 Fatty acid synthase
  Component type
   SPC_2554 (fabD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(2596437..2597315)
Genome map
AA seq 292 aa AA seqDB search
MLAEMAANYPIVEETFAEASAALGYDLWALTQQGPAEELNKTWQTQPALLTASVALWRVW
QQQGGKMPALMAGHSLGEYSALVCAGVINFADAVRLVEMRGKFMQEAVPEGTGGMSAIIG
LDDASIAKACEESAEGQVVSPVNFNSPGQVVIAGHKEAVERAGAACKAAGAKRALPLPVS
VPSHCALMKPAADKLAVELAKITFSAPTVPVVNNVDVKCETDAAAIRDALVRQLYNPVQW
TKSVEFIAAQGVEHLYEVGPGKVLTGLTKRIVDTLTASALNEPAALSAALTQ
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgttggccgaaatggcggcaaattaccctatcgtagaagaaacgtttgctgaagcttct
gcggctctgggatatgatctgtgggcgctcacccagcaaggtccagcggaagaactgaat
aaaacctggcagacgcagccggcgttattaaccgcttccgtcgcgctttggcgcgtttgg
cagcagcagggcggtaaaatgcctgcgttaatggcaggtcacagcctgggcgaatattcc
gcgctggtttgcgctggcgtcatcaactttgctgatgccgttcgtctggtggaaatgcgc
ggtaaattcatgcaggaagcggttccggaaggcactggcggcatgtctgcgatcatcggg
ctggatgatgcctctattgctaaagcctgtgaagaatctgccgaagggcaggttgtttcg
ccggttaactttaactcgccgggacaggtggttatcgccgggcataaagaggcggtagaa
cgtgcgggcgcagcctgtaaagccgctggcgcgaaacgcgcgctgccgctgccggtgagc
gtaccgtcgcactgcgcgctgatgaaaccagcggcagataagctggcggttgaattagcc
aaaattacctttagcgcgccaacggtgccggtagtaaacaacgttgacgtgaaatgtgaa
accgatgccgccgctatccgtgatgcgctggttcgccagttgtacaatccggtacagtgg
acgaagagcgtggaatttatcgcggcgcagggcgttgaacatctttatgaagtgggtcca
ggtaaagtcctcactggtctgacgaaacgtattgtcgacaccctgacagcgtcggcgctg
aacgagccggcggcgctgtctgcggcacttacgcaataa

DBGET integrated database retrieval system