KEGG   Salmonella enterica subsp. enterica serovar Paratyphi C: SPC_3050Help
Entry
SPC_3050          CDS       T00862                                 

Gene name
recD
Definition
exonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
sei  Salmonella enterica subsp. enterica serovar Paratyphi C
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:sei00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SPC_3050 (recD)
Enzymes [BR:sei01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     SPC_3050 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(3083540..3085375)
Genome map
AA seq 611 aa AA seqDB search
MTIQERLLEAVEQKLLRPIDAQFALTVAGNDDPAVTLAAALLSHDAGEGHVCLPLSRLTL
TEEAHPLLVAWISETATPIDWKKRLLESAAVSCGDRPAPLILCGDRLYLNRMWCNERTVA
RFFNEVNQAIAVDEDQLSRILDALFPPTEEVNWQKVAAAVALTRRISVISGGPGTGKTTT
VAKLLAALIQMADGERCRIRLAAPTGKAAARLTESLGAALRQLPLTDAQKKRIPEDASTL
HRLLGAQPGSQRLRHHAGNPLHLDVLVVDEASMIDLPMMSRLIDALPPHGRVIFLGDRDQ
LASVEAGAVLGDICAYVNAGFTAERARQLSRLTGSAIPAGAGTQAASLRDSLCLLQKSYR
FGSDSGIGKLAAAINCGDRSAIQAVFQQGFSDIEKRTLQSSDDYAGMLDEALAGYGRYLR
LLHEKATPEAILQAFNEYQLLCALREGPFGVRGLNDRIEQAMVQQRKIQRHPHSRWYEGR
PVMIARNDSALGLFNGDIGIALDRGQGLRVWFVMPDGTIKSVQPSRLPEHDTTWAMTVHK
SQGAEFDHAALILPSQRSPVVTRELVYTAVTRARRRLSLYADERILAGAIVTRTERRSGL
ATLFDEVSRTG
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atgacaatccaggagcggttgctggaggccgttgaacaaaaactcttacggcccattgat
gcccagtttgctttaaccgtcgccggtaacgacgatcccgccgtgacgctggcggcagcg
ctgcttagtcatgacgcaggtgaaggtcacgtgtgtctgccgttgtcgcgtttaacgtta
acggaggaggcgcatcccttactggtcgcctggataagcgaaacggctacgccaatcgac
tggaaaaagcggttactggagtctgcggcggttagctgcggcgataggcccgcgccgtta
attctgtgcggcgatcgcctctacctgaatcgcatgtggtgcaacgagcgtacggttgcg
cgcttttttaacgaggttaaccaggccatcgccgtagatgaagatcagttatcccgtatt
ctggacgcgctattccctccgacagaggaggtgaactggcaaaaggtggccgccgccgta
gcgctaactcgccgtatctccgtgatttcaggcggtcccggtaccggtaaaaccaccacc
gtcgcgaagctgctggcggcattaattcaaatggcggatggcgaacgttgccgtatccgg
ctggcagcgccgaccgggaaagcggccgcacgcctgacggagtcgctcggcgcggcgttg
cgtcagcttccacttaccgatgcgcagaaaaagcgtataccggaggacgccagtacgctg
caccgactgctaggcgcacagcccggcagccagcgattacgccatcatgcgggcaacccg
ctacatctggacgtgctggtggtcgatgaagcatcaatgattgatttgccgatgatgtca
cgtttgattgacgctctgccgccgcacgggcgggtcatttttcttggcgatcgcgatcag
ttggcatccgttgaggcgggcgctgtgttgggcgatatttgcgcctatgtcaacgcaggg
tttacggcggaacgcgcccgacagctaagtcgactcactggtagcgccattccggcgggg
gccggaacgcaagccgcatctttacgcgatagcctctgtttgttgcaaaagagctatcgt
ttcggcagcgattctggcatcggcaagctggcggcggcaattaactgcggcgacaggtcg
gcaatccaggctgtttttcagcaggggtttagcgatatagagaagcgtacattgcaaagc
agcgacgattatgccgggatgctggatgaagcgctggcgggctatggtcgctacctgcgg
ttgctgcatgaaaaagcgacgccggaggcaatccttcaggctttcaatgagtatcaactg
ctttgtgcgctgcgcgaaggcccatttggcgtgaggggattgaatgaccgcattgagcag
gcgatggtgcagcaacgaaaaattcagcggcacccgcattctcgctggtacgaagggcgt
ccggtaatgattgcgcgcaacgatagcgcgttggggctatttaacggcgatattggtatt
gcgctcgatcgcgggcaggggttacgcgtctggtttgtgatgccggacggcacgatcaag
tccgttcagcccagccgtctgccggaacatgatacaacctgggcgatgacggtacataaa
tcacagggggctgaatttgatcacgccgcgctgattttacccagccagcgttcgccggtc
gtgacgcgggagctggtgtataccgctgttacgcgagcgcggcggcggttatcgctgtat
gccgatgaacggatcctggcaggcgcgattgtgacgcgtacggagcggcgcagcgggcta
gccaccttatttgatgaagtcagtcgtaccggataa

DBGET integrated database retrieval system