KEGG   Salmonella enterica subsp. enterica serovar Paratyphi C: SPC_3141Help
Entry
SPC_3141          CDS       T00862                                 

Gene name
speB
Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
sei  Salmonella enterica subsp. enterica serovar Paratyphi C
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:sei00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    SPC_3141 (speB)
Enzymes [BR:sei01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     SPC_3141 (speB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(3177250..3178170)
Genome map
AA seq 306 aa AA seqDB search
MSTLGHQYDNSLVSNAFGFLRLPMNFQPYDSDADWVITGVPFDMATSGRAGGRHGPAAIR
QVSTNLAWEHHRFPWNFDMRERLNVVDCGDLVYAFGDAREMSEKLQAHAEKLLSAGKRML
SFGGDHFVTLPLLRAHAKHFGKMALVHFDAHTDTYANGCEFDHGTMFYTAPKEGLIDPHH
SVQIGIRTEFDKDNGFTVLDACQVNDRGVDDILAQVKQIVGDMPVYLTFDIDCLDPAFAP
GTGTPVIGGLTSDRAIKLVRGLKDLNIVGMDVVEVAPAYDQSEITALAAATLALEMLYIQ
AAKKGE
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccttaggtcatcagtacgataactcactggtttctaatgcgtttggtttttta
cgtctgccaatgaacttccagccgtatgacagcgatgccgactgggtgatcactggcgta
ccgtttgatatggcaacgtccggtcgcgctggcggtcgtcatggcccggcggcgatccgt
caggtgtcgaccaacctcgcctgggaacatcaccgtttcccgtggaattttgacatgcgc
gagcgcctgaacgtcgtggactgcggcgatttggtgtatgcgtttggcgatgcccgtgag
atgagtgaaaaattacaggcgcacgctgaaaaactgctgtctgcaggcaagcgtatgctc
tctttcggcggcgaccacttcgtcacgctgccgctgctgcgcgcccacgcgaaacatttt
ggcaaaatggcgctggtacattttgatgcgcataccgatacctacgctaacggctgcgaa
ttcgatcacggcacgatgttttacaccgcgccgaaagaaggcctgatcgatccgcatcat
tcggtacagatcggtattcgtactgagtttgacaaagacaatggctttaccgtgctggat
gcctgccaggtcaacgatcgcggcgtggatgatatcctcgctcaggtgaaacagatcgtc
ggcgatatgccggtctatctgacctttgatatcgactgtctggacccggcgtttgcgcct
ggcaccggtacgccggtgatcggcggtttgacctccgatcgcgccattaaactggtacgc
ggtctgaaagatctgaacattgtcggtatggatgtagtggaagtcgcgccggcttacgat
cagtcggagatcaccgctctggcggccgcgacgctggcattagaaatgctctatatccag
gcggcgaagaagggcgagtaa

DBGET integrated database retrieval system