KEGG   Salmonella enterica subsp. enterica serovar Paratyphi C: SPC_3607Help
Entry
SPC_3607          CDS       T00862                                 

Gene name
glgB
Definition
(GenBank) glycogen branching enzyme
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
sei  Salmonella enterica subsp. enterica serovar Paratyphi C
Pathway
sei00500  Starch and sucrose metabolism
sei01100  Metabolic pathways
sei01110  Biosynthesis of secondary metabolites
Module
sei_M00565  Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:sei00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SPC_3607 (glgB)
Enzymes [BR:sei01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     SPC_3607 (glgB)
Exosome [BR:sei04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SPC_3607 (glgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CBM_48 Alpha-amylase_C Alpha-amylase Glyco_hydro_70 Malt_amylase_C AMPK1_CBM
Motif
Other DBs
NCBI-ProteinID: ACN47689
UniProt: C0Q0L2
Position
complement(3637880..3640066)
Genome map
AA seq 728 aa AA seqDB search
MSSRIDRDVINALIAGHFADPFSVLGMHQTQAGLEVRALLPDATDVWVIEPKTGRKVGKL
ECLDARGFFCGVLPRRKNFFRYQLAVTWHGQQNLIDDPYRFGPLIQEMDAWLLSEGTHLR
PYETLGAHADTMDGVTGTRFSVWAPNARRVSVVGQFNYWDGRRHPMRLRKESGIWELFIP
GAHNGQLYKFELLDANGNLRIKADPYAFEAQMRPETASMICGLPEKVTPSEERQKANQFD
APISIYEVHLGSWRRHTDNNFWLSYRELADQLVPYAKWMGFTHLELLPVNEHPFDGSWGY
QPTGLYAPTRRFGTRDDFRYFINAAHAAGLNVILDWVPGHFPSDEFSLAEFDGTHLYEHS
DPREGYHQDWNTLIYNYGRREVSNYLVGNALYWMERFGIDALRVDAVASMIYRDYSRKEG
EWIPNEFGGRENLEAIEFLRNTNRIIGEQVPGAVSMAEESTDFAGVTRPPETGGLGFWYK
WNLGWMHDTLDYMKLDPVYRQYHHDKLTFGMLYNHTENFVLPLSHDEVVHGKKSILDRMP
GDAWQKFANLRAYYGWMWAFPGKKLLFMGNEFAQGREWNHDASLDWHLLEGGDNWHHGVQ
RLVRDLNHTYRHHKALHELDFDAYGFEWLVVDDNERSVLIFVRRDKAGNEIIVASNFTPV
PRHDYRFGINQPGRWREILNTDSMHYHGSNTGNGGVVHSDEIESHGRQHSLNLTLPPLAT
IWLMREGE
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atgtccagtcgtatcgatagagacgtgattaatgcgctaattgcaggacattttgcggac
cctttttccgtactcggaatgcaccagacccaagccggactagaagtccgcgccctatta
cctgacgccaccgacgtatgggtgattgaacccaagaccggacgtaaagtcggcaaactg
gaatgtctcgacgctcgcggttttttctgcggcgttttaccccgacgtaaaaatttcttt
cgctatcagctcgccgtgacctggcacggacagcagaacctcatcgacgatccttaccgt
tttggtccattaatacaggaaatggatgcctggctattgtcggaaggcacccacctgcgt
ccttatgaaacgctgggcgcgcacgccgatacgatggatggcgtcaccggcacccgtttc
tccgtctgggcgcctaatgctcgtcgcgtttcggttgtcgggcaattcaactattgggat
gggcgtcgccacccgatgcgtctgcgcaaagagagcggtatttgggagctgtttatcccc
ggcgcgcataatggacaactgtataaattcgagctgcttgatgcgaacggtaatctgcgc
attaaagccgatccctatgcttttgaggcgcagatgcgtccggaaacggcgtcgatgatt
tgcggactgccggagaaagtgacgccaagcgaagaacgacaaaaagccaatcagtttgat
gcgccgatctcgatttatgaggtgcatttaggttcatggcgccgccatacggataacaat
ttctggctgagctatcgtgagctggcggatcagcttgtgccttacgccaaatggatgggc
tttacgcaccttgaactcttgccggtcaacgaacatccgtttgacggcagttggggctac
cagccgaccggactctacgcgccgacccgccgctttggtacgcgggacgacttccgctat
ttcatcaatgcggcccatgcggcgggccttaacgtcattctcgactgggtgccgggccat
ttcccgtccgatgaatttagcctcgcggagtttgacggcacccacctctatgagcacagc
gacccgcgcgagggctatcaccaggactggaatacgctgatctacaactatggtcgtcgt
gaagtcagtaattatctggtgggtaacgccctgtactggatggagcgttttgggattgat
gcgctgcgtgtcgatgcggtggcctctatgatctaccgcgactacagccgcaaagagggc
gagtggataccgaacgagttcggtggtcgtgaaaacctggaagccattgagtttctgcgt
aataccaaccgcattattggcgagcaggtgcccggcgcggtcagcatggcggaagagtcg
acagacttcgctggcgtgacgcgtccaccggaaacgggcggcctggggttctggtacaag
tggaatctgggctggatgcacgacacgctggactacatgaagctggacccggtgtaccgc
cagtatcatcacgacaagctgacctttggtatgttgtacaaccataccgaaaactttgtt
ctgccgctgtcgcacgatgaggtggttcacggcaagaaatccattctcgatcgtatgccg
ggcgatgcgtggcaaaaatttgccaacctgcgcgcctattatggctggatgtgggccttc
cccggcaagaaactgctgtttatgggaaatgagtttgcccagggacgcgagtggaaccat
gacgccagcctcgactggcacttgctggaggggggcgataactggcaccacggggttcag
cgtctggtacgcgatctcaaccacacctatcgccaccataaagcgttgcatgagctggat
tttgatgcttacggctttgagtggctggtggtcgatgacaatgaacgctcggtactgatt
tttgtacgccgtgataaagccggtaacgagatcatcgtcgccagcaactttacgcccgtt
cctcgccacgactaccgctttggcatcaaccagccgggacgctggcgtgaaattctcaat
actgattcgatgcattatcacggtagcaacaccggcaatggcggcgtggtgcacagcgat
gagatcgaaagccatggccgtcagcactctcttaacctgacgttaccgccgttggcgacg
atctggctgatgcgggagggggaatga

DBGET integrated database retrieval system