KEGG   Salmonella enterica subsp. enterica serovar Paratyphi C: SPC_3671Help
Entry
SPC_3671          CDS       T00862                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
sei  Salmonella enterica subsp. enterica serovar Paratyphi C
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:sei00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SPC_3671
Enzymes [BR:sei01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     SPC_3671
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3706028..3706948
Genome map
AA seq 306 aa AA seqDB search
MKRDVVVIGSLNYDILIQQDRLPEVGETFTGNELMLMPGGKGANQAVQCSKLGLNVSMVG
CVGNDIYGEHLINALHENNVSVANVLKRGTTTGIGIVQILESGDYCSTIIKGANYLLNEN
DISDNLFDGKPLVILQSEIPSHIVEYVIKVASMYQCKVILNNAPARSIAPSTLSSVDYLV
VNETEASFMAGSEVSSIDDAHSCAAKLHKMVRSNVIITLGEKGAVLSSDESTMHFPAVFC
PEVIDTTGAGDSFIGGIAYCLVNNIPLTKAIPFAAEISMCSIQKYGGQSSFPMLADVAHA
LDYSDL
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagagatgtagttgttattggaagtcttaattacgacattcttattcagcaagat
cgtctgcctgaagtaggagaaacatttacgggtaatgaattgatgttaatgcctggtggt
aaaggtgctaatcaagcggtacagtgctcaaaactgggattgaacgtgagtatggtgggg
tgtgtagggaacgacatttatggcgagcacctcattaatgccctacatgaaaataatgtc
tccgttgctaacgtattgaaacggggaaccaccacaggtatcggcatcgtacagatcctt
gagtccggtgattattgtagcaccattattaaaggagctaactatctgttaaacgaaaat
gatattagcgataatttatttgatggaaaaccgctggtgattctgcaatcagaaatacct
tcacatatcgttgaatatgttattaaagtcgccagtatgtatcaatgcaaagttatactt
aataatgcgccagccagaagtatagcgccatcaacattaagttctgttgattacctggtc
gttaatgaaacagaagccagctttatggcaggtagtgaagtttcatcaattgatgacgct
cattcttgtgccgctaagttacataaaatggttaggagtaatgtcattataacattaggg
gaaaaaggcgcggtattatcctcggatgagtcaaccatgcactttccagcggtcttttgc
cctgaagttattgatactacaggtgctggcgattcatttatcggcggcattgcctactgc
ctggttaataatatccctttaacaaaggccatcccttttgctgctgaaataagcatgtgc
tcaattcaaaagtatggtggacaaagctcttttccaatgcttgcggatgttgctcatgcc
ttagactattccgacctgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system