KEGG   Salmonella enterica subsp. enterica serovar Paratyphi C: SPC_3854Help
Entry
SPC_3854          CDS       T00862                                 

Definition
glycosyl hydrolase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
sei  Salmonella enterica subsp. enterica serovar Paratyphi C
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:sei00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPC_3854
Enzymes [BR:sei01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     SPC_3854
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3909176..3910558
Genome map
AA seq 460 aa AA seqDB search
MRYRFPDNFWWGSACSALQTEGDSLNGGKSQTTWDVWFERQPDRFHQGVGPAETSTFYRH
WKQDIALLKQLKHNSFRTSLSWARLIPDGVGEVNPQAVSFYNHVIDELLAQGITPFITLF
HFDMPMVMQEKGGWENRDVVEAFGRYAQTCFTLFGDRVKHWFTFNEPIVPVEGGYLYDFH
YPNVVDFKRAATVAYHTVLAHSTAVRAWRAGRYDGEIGVVLNLTPSYPRSQHPADVQAAH
HADLLFNRSFLDPVLKGEYPTDLVALLKTYDQLPACQPGDRQLIADGKIDLLGINYYQPR
RVKCRDTAVNPQAPFMPEWLFDYYDMPGRKMNPYRGWEIYAPGIYDIITNLRDNYGNPRC
FISENGMGVENEQRFVQAGQIHDDYRIDFISEHLKWLHKGISEGCHCLGYHMWTFIDNWS
WLNGYKNRYGFVQLDLATQTRTVKKSGEWFAATAEHNGFD
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgcgataccgttttcccgataacttctggtggggcagcgcctgctcagcgttgcaaacc
gaaggggatagtctgaatggcggtaaaagccagaccacgtgggatgtgtggttcgagcgc
cagcctgatcgttttcaccagggcgtcggtccagcggaaacctcaacgttctatcgccac
tggaagcaagacatcgcgctactgaaacagttaaaacataacagttttcgcacctcgcta
agctgggcgcggctcattccagacggcgtaggcgaggtgaatccacaagcggtgagcttc
tacaatcacgtcatcgacgagctactggcgcagggcatcacgccgtttattacgctgttc
cattttgatatgccgatggtcatgcaggagaaaggcggctgggaaaatcgcgacgtcgta
gaggcgtttggtcggtacgcgcaaacgtgttttaccttgtttggcgaccgcgtgaagcac
tggtttacctttaacgagccgattgtgccggtggaaggcggctatttgtacgacttccac
tatcccaatgtggtggattttaaacgtgcagccaccgtggcgtaccataccgtgctggcg
cactcgaccgccgtgcgcgcctggcgcgccggacgctacgacggtgaaatcggcgtggtg
ctgaatctgacgccgtcctacccacgctcgcagcatcccgccgatgtgcaagccgcgcat
catgcggatctgttattcaaccgcagttttcttgacccggtattaaagggagaatacccg
acggacttggtggcgctgctgaaaacctatgaccagttgcctgcctgtcagccaggcgac
cgtcagcttattgccgacggcaaaatcgatttactggggattaactattatcagccgcgc
cgcgtgaaatgccgtgatacggcggtgaatccgcaagcgccgtttatgccggaatggtta
tttgactattacgacatgccggggcgcaagatgaacccttaccgcggctgggaaatttac
gcgccaggaatttacgacatcatcaccaacctgcgggataattacggcaatccgcgctgt
tttatctccgaaaacgggatgggcgttgagaacgagcagcgttttgtgcaagcgggacag
attcacgatgattaccggattgactttatctctgagcatcttaaatggctgcataaaggc
attagcgagggctgtcactgtcttggctaccacatgtggacctttatcgataactggtca
tggctgaacggctataaaaatcgctatggttttgtacaactggatttagccacccaaacg
cgcacggtgaaaaaaagcggagaatggtttgccgccaccgcagagcataacggttttgat
taa

DBGET integrated database retrieval system