KEGG   Salmonella enterica subsp. enterica serovar Paratyphi C: SPC_4068Help
Entry
SPC_4068          CDS       T00862                                 

Gene name
pldB
Definition
(GenBank) lysophospholipase L2
  KO
K01048  lysophospholipase [EC:3.1.1.5]
Organism
sei  Salmonella enterica subsp. enterica serovar Paratyphi C
Pathway
sei00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:sei00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    SPC_4068 (pldB)
Enzymes [BR:sei01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     SPC_4068 (pldB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 LIDHydrolase PGAP1
Motif
Other DBs
NCBI-ProteinID: ACN48134
UniProt: C0Q3D2
Position
4139463..4140479
Genome map
AA seq 338 aa AA seqDB search
MFQQQNDWETRENAFAAFAMGPLTDFWRQREEAEFIGVGNIPVRFVRFRNDSNDRTIVIC
PGRIESYVKYAELAYDLFHLGFDIFIIDHRGQGRSGRMLSDPHRGHVDHFNDYVEDLAAF
WQQEIEPGPWRKRYILAHSMGGAIATLFLQRHRVRCDAIALTAPMFGIVIRLPSFMVRHI
LDWAEGHQRIREDYAIGTGQWRALPFGMNALTHSRQRYQRNLRFYADEPQLRVGGPTWHW
VREGILAGEQVLAGASDDTTPTLLIQAEEERVVDNRTHDRFCEIRAAAGYPCEGGKPLVI
KGAYHEILFEKDAMRSVALNAIVEFFNKPNLSSGNRFA
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgtttcagcagcaaaatgactgggaaacaagagaaaatgcgtttgccgcttttgctatg
gggccgctgaccgatttctggcgtcagcgggaagaggcggagtttatcggcgtgggtaac
attccggtgcgctttgtccgttttcgaaatgattccaacgatcggacgatcgtcatttgt
cctggccgcattgagagttatgtaaaatacgctgaactggcgtatgacctttttcatctc
ggttttgatatcttcatcatcgaccaccgtggtcaagggcgctccgggcggatgttatcg
gacccgcatcggggtcatgtcgatcattttaacgattatgttgaggacttagcggcgttc
tggcagcaggaaattgagccggggccgtggcgtaagcgttatatcctggcgcactcaatg
gggggcgcgatagccaccctgttcctgcaacgccatcgtgtgcggtgcgacgctattgcg
ctcaccgcgccgatgtttggtattgtgatacgcttgccttcctttatggtgcgccatatt
ctcgactgggccgaagggcaccagcgtatccgtgaagattacgctattggtaccggtcag
tggcgggcgttgccgtttgggatgaatgcgctgacccacagccgccagcgttatcagcgc
aacttacgattttatgccgacgagccgcagctgcgcgttggcggccccacttggcattgg
gtacgcgaaggcattctggcgggtgagcaggtactggctggggcgagcgatgacacgacg
cctacgctactgattcaggcggaagaagagcgggtagtggataaccgcacccacgatcgt
ttttgtgaaattcgcgccgcggcgggatacccttgtgaagggggaaaaccgctggttatc
aaaggcgcgtaccatgagatcctttttgaaaaggacgccatgcgctcagtcgcgcttaac
gccattgttgaatttttcaacaagcctaatttatccagcggaaatcgctttgcttag

DBGET integrated database retrieval system