KEGG   Salmonella enterica subsp. enterica serovar Paratyphi C: SPC_4148Help
Entry
SPC_4148          CDS       T00862                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
sei  Salmonella enterica subsp. enterica serovar Paratyphi C
Pathway
sei00010  Glycolysis / Gluconeogenesis
sei00071  Fatty acid degradation
sei00350  Tyrosine metabolism
sei00625  Chloroalkane and chloroalkene degradation
sei00626  Naphthalene degradation
sei01100  Metabolic pathways
sei01110  Biosynthesis of secondary metabolites
sei01120  Microbial metabolism in diverse environments
sei01130  Biosynthesis of antibiotics
sei01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sei00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPC_4148
  Lipid metabolism
   00071 Fatty acid degradation
    SPC_4148
  Amino acid metabolism
   00350 Tyrosine metabolism
    SPC_4148
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SPC_4148
   00626 Naphthalene degradation
    SPC_4148
Enzymes [BR:sei01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SPC_4148
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 Glycolytic
Motif
Other DBs
NCBI-ProteinID: ACN48212
UniProt: C0Q3L0
Position
complement(4226180..4227331)
Genome map
AA seq 383 aa AA seqDB search
MMSFMLALPKISLHGAGAIADMVNLVANKQWGKALIVTDGQLVKLGLLDSLFSALDKHQM
SYHLFDEVFPNPTEELVQKGFAAYQSAECDYIIAFGGGSPIDTAKAVKILTANPGPSTAY
SGVGKVKNAGVPLVAINTTAGTAAEMTSNAVIIDSARKVKEVIIDPNIIPDIAVDDASVM
LEIPASVTAATGMDALTHAVEAYVSVGAHPLTDANALEAIRLINVWLPKAVDDGHNLEAR
EQMAFGQYLAGMAFNSAGLGLVHALAHQPGATHNLPHGVCNAILLPIVENFNRPNAVERF
ARIAQAMGVETRGMSDEAASQEAINAIRTLSKRVGIPEGFSKLGVTKEDIEGWLDKALAD
PCAPCNARTASRDEVRGLYLEAL
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
gtgatgagctttatgttggcactgccaaaaattagcctgcatggcgctggagcgattgcc
gatatggtgaacctcgtggcgaataagcaatggggcaaagcgctgatcgttaccgatggt
caactggtaaagctgggcctgctggatagcctgtttagcgcactggataaacatcaaatg
tcttaccacctgtttgatgaggtgttcccaaacccgacagaagagctggtgcagaaaggt
tttgcggcatatcagagcgcagaatgtgactacattatcgccttcggcggcggcagcccg
atcgataccgcaaaagcggtgaaaattctgaccgccaacccaggtccatctaccgcctac
tccggcgtcggcaaagtgaaaaacgccggcgtaccgctggtagcgattaacactacggca
ggtaccgcggcagagatgaccagcaacgcggtgattatcgactctgcccgtaaggtcaaa
gaggtgattatcgacccgaacatcatcccggatattgccgtggatgacgccagcgttatg
ctggaaatccccgcttctgtgaccgccgcaaccggcatggatgccctgacccatgcggtg
gaagcctatgtctccgttggcgcgcatccgctcaccgacgctaacgcgctggaagcgatt
cgcttaatcaatgtgtggctaccgaaagcggttgacgatggccataacctcgaagcccgt
gagcaaatggcattcggccagtacctggcgggtatggcgttcaacagcgccggtttgggg
ctggttcacgcgctggcgcaccagccgggcgcaacccacaacctgccgcacggcgtctgc
aacgctatcctgctgccaattgtcgagaactttaaccgtccgaatgccgtcgagcgtttt
gcccgcatcgcacaggcgatgggcgtggagacgcgcggtatgtctgacgaagccgcaagt
caggaagcgattaacgctatccgtacgctgagcaaacgcgtcggcattccagaaggtttc
agcaagctgggcgtcacaaaagaagatatcgaaggctggctggataaagccctcgccgac
ccgtgcgcgccgtgtaacgcgcgcaccgccagccgcgatgaagttcgcgggctgtacctg
gaggcgttatga

DBGET integrated database retrieval system