KEGG   Salmonella enterica subsp. enterica serovar Paratyphi C: SPC_4148Help
Entry
SPC_4148          CDS       T00862                                 

Definition
alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
sei  Salmonella enterica subsp. enterica serovar Paratyphi C
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sei00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SPC_4148
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPC_4148
  Lipid metabolism
   00071 Fatty acid degradation
    SPC_4148
  Amino acid metabolism
   00350 Tyrosine metabolism
    SPC_4148
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SPC_4148
   00626 Naphthalene degradation
    SPC_4148
Enzymes [BR:sei01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SPC_4148
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(4226180..4227331)
Genome map
AA seq 383 aa AA seqDB search
MMSFMLALPKISLHGAGAIADMVNLVANKQWGKALIVTDGQLVKLGLLDSLFSALDKHQM
SYHLFDEVFPNPTEELVQKGFAAYQSAECDYIIAFGGGSPIDTAKAVKILTANPGPSTAY
SGVGKVKNAGVPLVAINTTAGTAAEMTSNAVIIDSARKVKEVIIDPNIIPDIAVDDASVM
LEIPASVTAATGMDALTHAVEAYVSVGAHPLTDANALEAIRLINVWLPKAVDDGHNLEAR
EQMAFGQYLAGMAFNSAGLGLVHALAHQPGATHNLPHGVCNAILLPIVENFNRPNAVERF
ARIAQAMGVETRGMSDEAASQEAINAIRTLSKRVGIPEGFSKLGVTKEDIEGWLDKALAD
PCAPCNARTASRDEVRGLYLEAL
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
gtgatgagctttatgttggcactgccaaaaattagcctgcatggcgctggagcgattgcc
gatatggtgaacctcgtggcgaataagcaatggggcaaagcgctgatcgttaccgatggt
caactggtaaagctgggcctgctggatagcctgtttagcgcactggataaacatcaaatg
tcttaccacctgtttgatgaggtgttcccaaacccgacagaagagctggtgcagaaaggt
tttgcggcatatcagagcgcagaatgtgactacattatcgccttcggcggcggcagcccg
atcgataccgcaaaagcggtgaaaattctgaccgccaacccaggtccatctaccgcctac
tccggcgtcggcaaagtgaaaaacgccggcgtaccgctggtagcgattaacactacggca
ggtaccgcggcagagatgaccagcaacgcggtgattatcgactctgcccgtaaggtcaaa
gaggtgattatcgacccgaacatcatcccggatattgccgtggatgacgccagcgttatg
ctggaaatccccgcttctgtgaccgccgcaaccggcatggatgccctgacccatgcggtg
gaagcctatgtctccgttggcgcgcatccgctcaccgacgctaacgcgctggaagcgatt
cgcttaatcaatgtgtggctaccgaaagcggttgacgatggccataacctcgaagcccgt
gagcaaatggcattcggccagtacctggcgggtatggcgttcaacagcgccggtttgggg
ctggttcacgcgctggcgcaccagccgggcgcaacccacaacctgccgcacggcgtctgc
aacgctatcctgctgccaattgtcgagaactttaaccgtccgaatgccgtcgagcgtttt
gcccgcatcgcacaggcgatgggcgtggagacgcgcggtatgtctgacgaagccgcaagt
caggaagcgattaacgctatccgtacgctgagcaaacgcgtcggcattccagaaggtttc
agcaagctgggcgtcacaaaagaagatatcgaaggctggctggataaagccctcgccgac
ccgtgcgcgccgtgtaacgcgcgcaccgccagccgcgatgaagttcgcgggctgtacctg
gaggcgttatga

DBGET integrated database retrieval system