KEGG   Salmonella enterica subsp. enterica serovar Paratyphi C: SPC_4169Help
Entry
SPC_4169          CDS       T00862                                 

Gene name
pfkA
Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
sei  Salmonella enterica subsp. enterica serovar Paratyphi C
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:sei00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SPC_4169 (pfkA)
   01230 Biosynthesis of amino acids
    SPC_4169 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPC_4169 (pfkA)
   00030 Pentose phosphate pathway
    SPC_4169 (pfkA)
   00051 Fructose and mannose metabolism
    SPC_4169 (pfkA)
   00052 Galactose metabolism
    SPC_4169 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    SPC_4169 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    SPC_4169 (pfkA)
Enzymes [BR:sei01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SPC_4169 (pfkA)
Protein phosphatases and associated proteins [BR:sei01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     SPC_4169 (pfkA)
Messenger RNA biogenesis [BR:sei03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     SPC_4169 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4244702..4245664
Genome map
AA seq 320 aa AA seqDB search
MIKKIGVLTSGGDAPGMNAAIRGVVRAALTEGLEVMGIYDGYLGLYEDRMVQLDRYSVSD
MINRGGTFLGSARFPEFRDENIRAVAIENLKKRGIDALVVIGGDGSYMGAKRLTEMGFPC
IGLPGTIDNDIKGTDYTIGYFTALGTVVEAIDRLRDTSSSHQRISIVEVMGRYCGDLTLA
AAIAGGCEFIVVPEVEFNREDLVAEIKAGIAKGKKHAIVAITEHMCDVDELAHFIEKETG
RETRATVLGHIQRGGSPVPYDRILASRMGAYAIDLLLEGHGGRCVGIQNEQLVHHDIIDA
IENMKRPFKSDWMECAKKLY
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgattaagaaaatcggtgtgttgacaagcggcggtgatgcgccgggcatgaacgcggca
atccgcggtgttgtgcgcgcagcgttgacggaagggctggaagtcatgggcatttatgac
ggctatctgggcctgtatgaagatcgtatggttcagcttgaccgttacagcgtatctgac
atgatcaaccgtggcggtactttcctcggttctgcccgtttcccggaattccgtgacgaa
aatattcgcgctgtcgcgatcgaaaacctgaaaaaacgcggtatcgatgcgctggtagtt
attggcggcgacggttcttatatgggtgcaaaacgtctgactgaaatgggcttcccgtgc
atcggtctgccaggcactatcgataacgacatcaaaggcaccgactacactatcggctat
ttcactgctctcggcactgtagtggaagcgattgaccgtctgcgtgacacctcctcttct
caccagcgtatctctatcgttgaggtgatgggccgttattgcggcgacctgacgttggcg
gcggctattgctggcggctgtgagtttatcgtggtgccggaagttgaatttaatcgcgaa
gatctggtggccgaaatcaaagccgggatcgcgaaagggaaaaaacacgctatcgtcgct
attactgagcatatgtgcgatgttgacgagctggcgcactttattgaaaaagaaacgggc
cgtgaaacgcgtgcgacggtgctcggccacattcagcgcggtggttccccggtaccttac
gatcgcattctggcttcccgtatgggcgcgtatgctattgacctgctgctggaaggccat
ggcggtcgttgtgtcggtatccagaacgagcagcttgttcatcatgacatcatcgatgcg
attgaaaacatgaagcgtccgttcaaaagcgactggatggagtgcgcgaaaaaactgtac
tga

DBGET integrated database retrieval system