KEGG   Salmonella enterica subsp. enterica serovar Paratyphi C: SPC_4187Help
Entry
SPC_4187          CDS       T00862                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sei  Salmonella enterica subsp. enterica serovar Paratyphi C
Pathway
sei00010  Glycolysis / Gluconeogenesis
sei00051  Fructose and mannose metabolism
sei00562  Inositol phosphate metabolism
sei01100  Metabolic pathways
sei01110  Biosynthesis of secondary metabolites
sei01120  Microbial metabolism in diverse environments
sei01130  Biosynthesis of antibiotics
sei01200  Carbon metabolism
sei01230  Biosynthesis of amino acids
Module
sei_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sei_M00002  Glycolysis, core module involving three-carbon compounds
sei_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sei00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPC_4187 (tpiA)
   00051 Fructose and mannose metabolism
    SPC_4187 (tpiA)
   00562 Inositol phosphate metabolism
    SPC_4187 (tpiA)
Enzymes [BR:sei01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SPC_4187 (tpiA)
Exosome [BR:sei04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SPC_4187 (tpiA)
  Exosomal proteins of bladder cancer cells
   SPC_4187 (tpiA)
  Exosomal proteins of melanoma cells
   SPC_4187 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM DUF3254
Motif
Other DBs
NCBI-ProteinID: ACN48250
UniProt: C0Q431
Position
complement(4262635..4263384)
Genome map
AA seq 249 aa AA seqDB search
MGNWKLNGSRHMVNELVANLRKELTGVAGCDVAIAPPEMYIDLAKRAAAGSHIMLGAQNV
DLNLSGAFTGETSAEMLKDIGAQYIIIGHSERRTYHKESDELIAKKFAVLKEQGLTPVLC
IGETEAENEAGKTEEVCARQIDAVLKTQGAAAFEGAVIAYEPVWAIGTGKSATPAQAQAV
HKFIRDHIAKADAKIAEQVIIQYGGSVNASNAAELFAQPDIDGALVGGASLKADAFAVIV
KAAEAAKQA
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgggtaactggaaactgaacggcagccgccacatggtaaacgaactggtggctaacctg
cgtaaagaactgacgggcgtagcaggctgcgacgtggcaatcgctccgccggaaatgtat
atcgatctggcgaaacgcgctgctgccggcagccacatcatgctgggcgcgcagaacgtt
gatctgaatctgtctggcgcattcaccggtgaaacttcggctgaaatgctgaaggatatc
ggcgcgcagtacattattatcggccactccgagcgtcgtacttatcacaaagaatctgac
gagctgatcgccaaaaaattcgccgtactgaaagaacaaggtctgacgccggtactgtgc
atcggtgaaaccgaagcggaaaacgaagcgggcaaaacagaagaagtgtgcgcacgccag
atcgacgcggtactgaaaacgcagggcgcggcagcctttgaaggcgcggttatcgcttac
gaacccgtatgggcgatcggtaccggtaaatctgcaactcctgcgcaggctcaggcagtg
cacaaattcatccgcgaccacattgctaaagctgacgcgaaaatcgctgaacaggttatt
atccagtacggcggttctgttaatgcctccaacgcagccgaactgttcgcgcaaccggac
atcgacggcgcactggtaggcggcgcttctctgaaagctgatgccttcgcggtgatcgtg
aaagcagcagaagctgctaaacaggcttaa

DBGET integrated database retrieval system