KEGG   Salmonella enterica subsp. enterica serovar Paratyphi C: SPC_4187Help
Entry
SPC_4187          CDS       T00862                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sei  Salmonella enterica subsp. enterica serovar Paratyphi C
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sei00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SPC_4187 (tpiA)
   01230 Biosynthesis of amino acids
    SPC_4187 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPC_4187 (tpiA)
   00051 Fructose and mannose metabolism
    SPC_4187 (tpiA)
   00562 Inositol phosphate metabolism
    SPC_4187 (tpiA)
Enzymes [BR:sei01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SPC_4187 (tpiA)
Exosome [BR:sei04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SPC_4187 (tpiA)
  Exosomal proteins of bladder cancer cells
   SPC_4187 (tpiA)
  Exosomal proteins of melanoma cells
   SPC_4187 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4262635..4263384)
Genome map
AA seq 249 aa AA seqDB search
MGNWKLNGSRHMVNELVANLRKELTGVAGCDVAIAPPEMYIDLAKRAAAGSHIMLGAQNV
DLNLSGAFTGETSAEMLKDIGAQYIIIGHSERRTYHKESDELIAKKFAVLKEQGLTPVLC
IGETEAENEAGKTEEVCARQIDAVLKTQGAAAFEGAVIAYEPVWAIGTGKSATPAQAQAV
HKFIRDHIAKADAKIAEQVIIQYGGSVNASNAAELFAQPDIDGALVGGASLKADAFAVIV
KAAEAAKQA
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgggtaactggaaactgaacggcagccgccacatggtaaacgaactggtggctaacctg
cgtaaagaactgacgggcgtagcaggctgcgacgtggcaatcgctccgccggaaatgtat
atcgatctggcgaaacgcgctgctgccggcagccacatcatgctgggcgcgcagaacgtt
gatctgaatctgtctggcgcattcaccggtgaaacttcggctgaaatgctgaaggatatc
ggcgcgcagtacattattatcggccactccgagcgtcgtacttatcacaaagaatctgac
gagctgatcgccaaaaaattcgccgtactgaaagaacaaggtctgacgccggtactgtgc
atcggtgaaaccgaagcggaaaacgaagcgggcaaaacagaagaagtgtgcgcacgccag
atcgacgcggtactgaaaacgcagggcgcggcagcctttgaaggcgcggttatcgcttac
gaacccgtatgggcgatcggtaccggtaaatctgcaactcctgcgcaggctcaggcagtg
cacaaattcatccgcgaccacattgctaaagctgacgcgaaaatcgctgaacaggttatt
atccagtacggcggttctgttaatgcctccaacgcagccgaactgttcgcgcaaccggac
atcgacggcgcactggtaggcggcgcttctctgaaagctgatgccttcgcggtgatcgtg
aaagcagcagaagctgctaaacaggcttaa

DBGET integrated database retrieval system