KEGG   Salmonella enterica subsp. enterica serovar Paratyphi C: SPC_4693Help
Entry
SPC_4693          CDS       T00862                                 

Gene name
holD
Definition
(GenBank) DNA polymerase III subunit psi
  KO
K02344  DNA polymerase III subunit psi [EC:2.7.7.7]
Organism
sei  Salmonella enterica subsp. enterica serovar Paratyphi C
Pathway
sei00230  Purine metabolism
sei00240  Pyrimidine metabolism
sei01100  Metabolic pathways
sei03030  DNA replication
sei03430  Mismatch repair
sei03440  Homologous recombination
Module
sei_M00260  DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:sei00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    SPC_4693 (holD)
   00240 Pyrimidine metabolism
    SPC_4693 (holD)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    SPC_4693 (holD)
   03430 Mismatch repair
    SPC_4693 (holD)
   03440 Homologous recombination
    SPC_4693 (holD)
Enzymes [BR:sei01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     SPC_4693 (holD)
DNA replication proteins [BR:sei03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     SPC_4693 (holD)
DNA repair and recombination proteins [BR:sei03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    DNA polymerase III holoenzyme
     SPC_4693 (holD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_III_psi CSTF_C
Motif
Other DBs
NCBI-ProteinID: ACN48736
UniProt: C0Q7L3
Position
4791970..4792407
Genome map
AA seq 145 aa AA seqDB search
MTSRRDWQLQQLGITQWALRRPGALQGEIAISLPAHVRLIVVAEELPALNEPLMRDILRA
LTVSPDQVLPLTPERVAMLPQGSRCNSWRLGTDAPLQLEGAQVTTPAFNELRANPAARAA
LWQQICEHEHDFYPQHDRSPRSLAD
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atgacatcccgacgagactggcagttacagcaactgggtattacgcagtgggcgctgcga
cgtcctggcgcgctacagggcgagattgcgatttcccttcccgcgcacgttcgtctgatc
gtggttgcagaggaattacccgcgctgaacgagccgctaatgcgcgatatcttacgcgcg
ttgaccgtgagtcccgatcaggttttaccgctgacgcctgagcgcgtcgccatgctgccg
cagggcagccgttgtaatagctggcggttaggaactgatgcgccgctccaactcgaaggc
gctcaggtcacgacgccggcgtttaatgaactccgggcaaacccggcggcacgcgccgca
ctatggcaacaaatctgcgaacatgaacacgatttctatcctcagcacgaccgatctccc
cgcagcctggcagattga

DBGET integrated database retrieval system