KEGG   Salmonella enterica subsp. enterica serovar Paratyphi C: SPC_4704Help
Entry
SPC_4704          CDS       T00862                                 

Gene name
deoA
Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
sei  Salmonella enterica subsp. enterica serovar Paratyphi C
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sei00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    SPC_4704 (deoA)
Enzymes [BR:sei01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     SPC_4704 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4801927..4803357
Genome map
AA seq 476 aa AA seqDB search
MALRLSGLQIQACRPDKALTAIRRCKPSTLFPQEGTVFLAQEIIRKKRDGHALSDEEIRF
FINGIRDNTISEGQIAALAMTIFFHDMTMPERVSLTMAMRDSGTVLDWKSLNLNGPIVDK
HSTGGVGDVTSLMLGPMVAACGGYVPMISGRGLGHTGGTLDKLEAIPGFDIFPDDNRFRE
IIQDVGVAIIGQTSSLAPADKRFYATRDITATVDSIPLITGSILAKKLAEGLDALVMDVK
VGSGAFMPTYELSEALAEAIVGVANGAGVRTTALLTDMNQVLASSAGNAVEVREAVQFLT
GEYRNPRLFDVTMALCVEMLISGQLAKDDAEARTKLQAVLDNGKAAEVFGRMVAAQKGPS
DFVENYDKYLPTAMLSKAVYADTEGFISAMDTRALGMAVVSMGGGRRQASDTIDYSVGFT
DMARLGDSIDGQRPLAVIHAKDEASWQEAAKAVKAAIILDDKAPVSTPSVYRRITE
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgcgcttatccggcctacaaatccaggcctgtaggccggataaggcgttaacc
gccatccggcgatgtaagccttctactcttttccctcaggagggtaccgtgtttctcgca
caagaaattattcgtaaaaagcgtgatggtcatgcgttgagtgacgaagaaattcgtttc
tttatcaatggtattcgtgacaatactatctctgaagggcagattgccgccctggcgatg
accatcttcttccacgatatgaccatgccggagcgtgtttcgctgaccatggcgatgcgg
gattccggtactgtccttgactggaaaagcctgaatctcaatggcccgattgtcgataag
cattcgaccggcggcgtaggggacgtgacgtctctgatgttggggccaatggtagcggcc
tgcggcggttatgtgccgatgatctccggtcgcggcctcggacataccggcggtacgctc
gacaaactggaagcgatcccgggcttcgatatcttcccggacgacaaccgtttccgcgaa
attattcaagacgtgggtgtggcgattattgggcaaaccagctcgcttgcaccggcggac
aaacgtttttacgccacccgcgatattaccgcgacggtggactctattccgctgatcacc
ggctccatcctcgccaagaaactggccgaagggctggatgcgctggtaatggacgtaaaa
gtcggcagcggcgcgtttatgccaacctatgaactttctgaagcccttgctgaagcgatt
gtcggcgtggcaaatggcgcgggagttcgcactacggcgttgttaaccgatatgaaccag
gtgctggcttcaagcgccggtaacgcggtggaagtgcgtgaagccgtgcagttcctgacc
ggtgaataccgcaatccgcgcttgtttgacgttaccatggcgctatgcgtggagatgctg
atctccggtcagctggcgaaagacgacgccgaagcgcgtaccaaactgcaggcggtgctg
gataacggtaaagcggcagaagtctttggtcgtatggtggccgcgcagaaagggccgagc
gatttcgttgagaactacgataaatacctgccgaccgccatgttgagcaaagcggtatat
gctgataccgaagggtttatcagcgcaatggatacgcgtgcgctggggatggcggtcgtc
tcgatgggcggcggccgtcgtcaggcgtctgataccattgattacagcgttggctttacc
gacatggcccgtctgggcgacagcatcgacgggcagcgcccgctggcggtgattcatgcc
aaagacgaagccagttggcaggaagcggcgaaggccgtcaaagcggcaattatccttgac
gataaagcgccagtaagcacaccttcggtctatcgtcgaattactgaatag

DBGET integrated database retrieval system