KEGG   Salmonella enterica subsp. enterica serovar Typhimurium UK-1: STMUK_1735Help
Entry
STMUK_1735        CDS       T01743                                 

Gene name
narH
Definition
nitrate reductase 1 subunit beta
Orthology
K00371  
nitrate reductase beta subunit [EC:1.7.99.4]
Organism
sej  Salmonella enterica subsp. enterica serovar Typhimurium UK-1
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Two-component system
Module
Dissimilatory nitrate reduction, nitrate => ammonia
Brite
KEGG Orthology (KO) [BR:sej00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    STMUK_1735 (narH)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    STMUK_1735 (narH)
Enzymes [BR:sej01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.99  With other acceptors
    1.7.99.4  nitrate reductase
     STMUK_1735 (narH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(1815762..1817297)
Genome map
AA seq 511 aa AA seqDB search
MKIRSQVGMVLNLDKCIGCHTCSVTCKNVWTSREGMEYAWFNNVESKPGVGFPNDWENQE
KWKGGWIRKINGKLQPRMGNRALLLGKIFANPHLPGIDDYYEPFDYDYQNLHTAPESKHQ
PIARPRSLITGQRMDKITSGPNWEEILGGEFEKRAKDQNFENMQKAMYGQFENTFMMYLP
RLCEHCLNPACVATCPSGAIYKREEDGIVLIDQDKCRGWRMCITGCPYKKIYFNWKSGKS
EKCIFCYPRIEAGQPTVCSETCVGRIRYLGVLLYDADAIESAASTENEKDLYQRQLDVFL
DPNDPAVIEQALKDGVPQSVIDAAQQSPVYKMAIDWKLALPLHPEYRTLPMVWYVPPLSP
IQSAADAGELGSNGILPDVDSLRIPVQYLANLLTAGDTQPVLLALKRMLAMRHYKRAETV
DGKVDTRALEEVGLSEAQAQEMYRYLAIANYEDRFVVPSSHRELARDAFPEKSGCGFTFG
DGCHGSDTKFNLFNSRRIDAVDVTSKTEPHA
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattcgttcacaagtcggcatggtgctgaatctcgataagtgcatcggctgtcat
acctgttcagtcacctgtaaaaacgtctggaccagtcgcgaaggtatggaatacgcctgg
ttcaacaacgtagaaagtaagcctggcgttggttttccgaatgactgggaaaatcaggaa
aaatggaaaggcggctggatccgcaaaattaacggcaagctacagccgcgcatgggcaac
cgggcgctgctgctgggtaaaatcttcgctaacccgcatctgccgggcatcgacgactac
tacgagccgtttgattacgactaccagaacctgcataccgcgccggaaagcaaacatcag
ccgatcgcgcgtccgcgctcgctgattaccggccagcggatggacaaaattaccagcggg
ccaaactgggaagagattctgggcggcgagttcgaaaaacgcgctaaagaccagaacttt
gaaaacatgcagaaggcgatgtacggccagttcgaaaacaccttcatgatgtacctgccg
cgcctgtgcgagcactgtctcaacccggcgtgcgtggcgacctgcccgagcggtgctatc
tacaagcgtgaagaagatggcatcgtgctgatcgaccaggacaagtgccgcggctggcgg
atgtgcatcaccggctgcccgtacaagaagatttacttcaactggaagagcggcaagtcc
gagaagtgcatcttctgctacccgcgtatcgaagctggtcagccgactgtttgctcggaa
acctgcgtgggtcgtatccgttatcttggcgtactgctgtatgacgccgatgccattgaa
agcgccgccagtacggaaaacgaaaaagatctgtaccagcgtcaactggacgtgttcctc
gatccaaacgatccggctgtcattgagcaggcgctgaaggacggcgtgccgcagagcgtg
atcgatgcggcgcagcaatcgccagtgtacaaaatggcgattgactggaagctggcgctg
ccgctgcatccggaataccgcacgctaccgatggtctggtacgtaccgcctttgtcaccg
attcagtctgccgccgatgcgggcgaacttggcagcaacggtattctgccggatgtagac
agtctgcgtatcccggtgcagtacctggcgaacctgttgactgctggcgacacccagccg
gtactgttggcgctgaaacggatgctggcgatgcgtcactacaaacgtgcggaaaccgta
gacggtaaagtggatacccgcgcgctggaagaggtgggtttaagcgaagcccaggcgcag
gaaatgtatcgttacctggcaattgctaattatgaagatcgctttgtggtgccgagcagc
catcgtgaactggcgcgtgacgcattcccggagaaaagcggttgtggctttaccttcggc
gatggttgccacgggtctgataccaaattcaatctgttcaacagccgccgcatcgacgct
gttgatgtgaccagcaaaacggagccgcacgcatga

DBGET integrated database retrieval system