KEGG   Salmonella enterica subsp. enterica serovar Typhimurium UK-1: STMUK_2128Help
Entry
STMUK_2128        CDS       T01743                                 

Gene name
galF
Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase subunit GalF
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
sej  Salmonella enterica subsp. enterica serovar Typhimurium UK-1
Pathway
sej00040  Pentose and glucuronate interconversions
sej00052  Galactose metabolism
sej00500  Starch and sucrose metabolism
sej00520  Amino sugar and nucleotide sugar metabolism
sej01100  Metabolic pathways
sej01130  Biosynthesis of antibiotics
Module
sej_M00362  Nucleotide sugar biosynthesis, prokaryotes
sej_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sej00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    STMUK_2128 (galF)
   00052 Galactose metabolism
    STMUK_2128 (galF)
   00500 Starch and sucrose metabolism
    STMUK_2128 (galF)
   00520 Amino sugar and nucleotide sugar metabolism
    STMUK_2128 (galF)
Enzymes [BR:sej01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     STMUK_2128 (galF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 CTP_transf_3 EFP_N
Motif
Other DBs
NCBI-ProteinID: AEF08016
Position
complement(2178702..2179595)
Genome map
AA seq 297 aa AA seqDB search
MMNLKAVIPVAGLGMHMLPATKAIPKEMLPIVDKPMIQYIVDEIVAAGIKEIVLVTHASK
NAVENHFDTSYELESLLEQRVKRQLLAEVQSICPPGVTIMNVRQAQPLGLGHSILCARPV
VGDNPFIVVLPDIIIDDATADPLRYNLAAMVARFNETGRSQVLAKRMKGDLSEYSVIQTK
EPLDNEGKVSRIVEFIEKPDQPQTLDSDLMAVGRYVLSADIWAELERTEPGAWGRIQLTD
AIAELAKKQSVDAMLMTGDSYDCGKKMGYMQAFVKYGLRNLKEGAKFRKSIEQLLHE
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgatgaatttgaaagcagttataccggtagcgggtttgggtatgcatatgttgcctgcc
accaaggcaatcccaaaagagatgctaccgatcgtcgacaagccaatgattcagtacatt
gtcgatgagattgtggctgcagggatcaaagaaatcgtgctggtgactcacgcgtctaaa
aacgccgttgagaaccacttcgacacctcttatgaacttgaatcacttcttgagcagcgc
gttaagcgtcagcttttggcggaagtgcaatctatctgcccaccgggcgtgacgattatg
aacgttcgccaggcgcagccgttagggctggggcattctattctgtgcgcgcgtccggtc
gtgggcgataaccctttcattgtggtactcccggatattattatcgatgatgctaccgcc
gatccgctgcgctataaccttgcggcgatggtggcgcgtttcaatgaaacgggtcgcagc
caggtgctggcgaagcgcatgaaaggtgatttatcggagtattccgttatccagacgaaa
gaacctctggataatgaaggcaaagtcagccggattgtggagtttatcgaaaaaccggat
cagccgcagacgctggattccgatttgatggcggtaggccgttatgtgctttcagccgac
atctgggcggaactggaaagaaccgaaccgggcgcctggggccgcatccagctcaccgat
gccattgctgaactggcgaaaaaacagtcggttgacgcgatgctaatgacgggtgacagc
tatgactgcggtaaaaaaatgggctacatgcaggcatttgtgaagtacgggctgcgcaac
ctgaaagaaggagccaagttccgtaagagcatagagcagcttttgcatgaataa

DBGET integrated database retrieval system