KEGG   Salmonella enterica subsp. enterica serovar Typhimurium UK-1: STMUK_2964Help
Entry
STMUK_2964        CDS       T01743                                 

Gene name
fucI
Definition
L-fucose isomerase
Orthology
K01818  
L-fucose isomerase [EC:5.3.1.25]
Organism
sej  Salmonella enterica subsp. enterica serovar Typhimurium UK-1
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:sej00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3095598..3097373
Genome map
AA seq 591 aa AA seqDB search
MKKISLPKIGIRPVIDGRRMGVRESLEEQTMNMAKATAALITEKIRHACGAQVECVIADT
CIAGMAESAACEEKFSSQNVGVTITVTPCWCYGSETIDMDPMRPKAIWGFNGTERPGAVY
LAAALAAHSQKGIPAFSIYGHDVQDADDTSIPADVEEKLLRFARAGLAVASMKGKSYLSV
GGVSMGIAGSIVDHNFFESWLGMKVQAVDMTELRRRIDQKIYDEAELEMALAWADKNFRY
GEDQNASQYKRNEAQNRAVLKESLLMAMCIRDMMQGNKTLADKGLVEESLGYNAIAAGFQ
GQRHWTDQYPNGDTAEALLNSSFDWNGVREPFVVATENDSLNGVAMLFGHQLTGTAQIFA
DVRTYWSPEAVERVTGQALSGLAEHGIIHLINSGSAALDGACKQRDSEGKPTMKPHWEIS
QQEADACLAATEWCPAIHEYFRGGGYSSRFLTEGGVPFTMTRVNIIKGLGPVLQIAEGWS
VELPKAMHDQLDARTNSTWPTTWFAPRLTGKGPFTDVYSVMANWGANHGVLTIGHVGADF
ITLAAMLRIPVCMHNVEEAKIYRPSAWAAHGMDIEGQDYRACQNYGPLYKR
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatcagcttaccgaaaatcggtatccgcccggtgattgatggacgtcgtatg
ggcgtacgcgagtcgctcgaagagcaaaccatgaacatggcgaaagcgacggcggcgctc
atcaccgagaaaatccgccacgcctgcggggctcaggtggagtgcgtcattgcggatacc
tgtattgccggaatggcggaatccgccgcctgtgaagaaaaattcagtagccagaacgtg
ggcgtgaccattaccgttacgccgtgctggtgctatggcagcgaaaccattgatatggac
ccgatgcgtccgaaagccatctggggctttaacggcacagagcgtcctggggcggtttac
cttgccgcggcgctggcggcgcacagccagaaaggcattccagcgttctccatttatggc
catgacgtgcaggatgccgacgatacctccattcctgccgacgtcgaagaaaaactgctg
cgttttgcgcgggcagggttagcggtagccagcatgaaaggcaaaagctacctctccgtc
ggcggcgtgtcgatggggatcgcgggttccattgtcgatcataacttctttgaatcctgg
ctgggcatgaaggtgcaagcggtagatatgaccgaactgcgccgccgtatcgatcaaaaa
atttatgatgaggccgaactggagatggcgctggcgtgggcggataaaaacttccgctac
ggcgaagatcagaacgcctcgcagtataagcgcaatgaagcccagaaccgcgcggtgtta
aaagagagcctgctgatggcgatgtgtattcgcgacatgatgcagggcaacaagacgctg
gcggacaaagggttagttgaagaatcgctgggctacaacgccattgccgccggcttccag
ggccagcgccactggaccgatcaatacccgaatggcgataccgccgaagcgctgctcaat
agttcttttgactggaacggcgtacgcgaaccgtttgtcgtcgccaccgaaaatgacagt
ctgaacggcgtagcgatgctgttcggccatcaactcaccggtaccgcgcagatattcgcc
gacgtgcgaacctactggtcgccggaagccgtagaacgcgtcaccggccaggcactcagc
ggcctggcggaacacggcattattcacctgattaattccggttctgccgctctggacggt
gcctgtaaacagcgcgacagcgaaggcaagccgaccatgaaaccgcactgggaaatcagc
caacaagaggcggatgcgtgtctggcggccaccgaatggtgcccggcgattcacgaatac
ttccgcggcggcggctactcatcccgtttcctgaccgaaggcggcgtaccattcaccatg
acccgcgtgaatatcatcaaaggcctggggccagtactgcaaatcgccgagggctggagc
gtcgaactgccgaaagcgatgcacgatcagcttgatgcccgcaccaactctacctggcct
actacctggtttgcgccgcgtcttaccggcaaaggcccgtttaccgatgtctattcggtg
atggcgaactggggcgctaaccacggcgtactcaccatcggccatgtaggggcggacttt
attactctcgccgcgatgctgcgtatcccggtatgtatgcacaacgtggaggaggcgaag
atctaccgtccttccgcctgggcggctcacggtatggatatcgaaggccaggattatcgc
gcctgccagaattatggcccgctgtataaacgttaa

DBGET integrated database retrieval system