KEGG   Salmonella enterica subsp. enterica serovar Typhimurium UK-1: STMUK_3923Help
Entry
STMUK_3923        CDS       T01743                                 

Gene name
hemD
Definition
(GenBank) uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
sej  Salmonella enterica subsp. enterica serovar Typhimurium UK-1
Pathway
sej00860  Porphyrin and chlorophyll metabolism
sej01100  Metabolic pathways
sej01110  Biosynthesis of secondary metabolites
sej01120  Microbial metabolism in diverse environments
Module
sej_M00121  Heme biosynthesis, glutamate => heme
sej_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:sej00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    STMUK_3923 (hemD)
Enzymes [BR:sej01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     STMUK_3923 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: AEF09756
Position
complement(4105609..4106349)
Genome map
AA seq 246 aa AA seqDB search
MSILITRPSPAGEALVSRLRALGQVAWSFPLIEFVAGRELPTLADRLATLTENDLVFALS
QHAVAFAHAQLQRDGRNWPVAPRYFAIGRTTALALHTVSGFDIRYPLDREISEALLQLPE
LQNIAGKRALILRGNGGRELLGETLTARGAEVSFCECYQRCAKHYDGAEEAMRWHTRGVT
TLVVTSGEMLQRLWSLTPQWYREHWLLRCRLLVVSERLAHLARELGWQDIKVADNADNDA
LLRALQ
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgagtattctgatcacccgcccctctcccgcaggggaagcgttagtgagccgtctgcgc
gcactggggcaggtggcctggagttttccactgattgaatttgtcgccggtcgggagcta
cccaccctggccgaccgcctggcgacgctgacggaaaacgatctggtttttgccctttca
cagcacgctgtcgcctttgctcacgcccagctccagcgggatggtcgaaactggcctgtg
gcgccgcgctatttcgcgattggccgcaccacggcgctcgcccttcataccgttagcggg
ttcgatattcgttatccattggatcgggaaatcagcgaagccttgctacaattacctgaa
ttacaaaatattgcgggcaaacgcgcgctgattttgcgtggcaatggcggccgcgaactg
ctgggcgaaaccctgacagcgcgcggagccgaagtcagtttttgtgaatgttatcaacga
tgtgcgaaacattacgatggcgcggaagaagcgatgcgctggcatactcgcggcgtaaca
acgcttgttgttaccagcggcgagatgttgcaacggctctggtcgctgactccccagtgg
tatcgtgagcactggttactacgctgtcggctattggtcgtcagtgagcgtctggcgcac
ctcgcccgggaactgggctggcaagatattaaggtcgctgataacgccgacaacgatgcg
ctgttgcgcgcattacaataa

DBGET integrated database retrieval system