KEGG   Salmonella enterica subsp. enterica serovar Typhimurium UK-1: STMUK_4071Help
Entry
STMUK_4071        CDS       T01743                                 

Gene name
glpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
sej  Salmonella enterica subsp. enterica serovar Typhimurium UK-1
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:sej00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(4255533..4257041)
Genome map
AA seq 502 aa AA seqDB search
MTEKKYIVALDQGTTSSRAVVMDHDANIVSVSQREFEQIYPKPGWVEHDPMEIWASQSST
LVEVLAKADISSDQIAAIGITNQRETAIVWERETGKPIYNAIVWQCRRTADICEQLKRDG
LEDYIRDNTGLVVDPYFSGTKVKWILDHVEGSRERAKRGELLFGTVDTWLIWKMTQGRVH
VTDYTNASRTMLFNIHDLDWDDKMLDVLDIPRAMLPQVRKSSEVYGQTNIGGKGGTRIPI
AGIAGDQQAALFGQLCVKEGMAKNTYGTGCFMLMNTGEKAVKSENGLLTTIACGPSGEVN
YALEGAVFMAGASIQWLRDEMKLISDAFDSEYFATKVKDTNGVYVVPAFTGLGAPYWDPY
ARGAIFGLTRGVNSNHIIRATLESIAYQTRDVLEAMQADSGIRLHALRVDGGAVANNFLM
QFQSDILGTRVERPEVREVTALGAAYLAGLAVGYWQNLDELQEKAVIEREFRPGIETTER
NYRYSGWKKAVKRAMAWEEHDK
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgactgaaaaaaaatatatcgttgcgctcgaccagggtaccaccagctcccgcgcggtc
gttatggatcatgacgcgaatatcgtcagcgtatcacagcgtgaatttgagcaaatttat
cctaagccaggctgggtagaacacgacccgatggaaatttgggcgtcccaaagctcaacg
ctggtagaagtgctggctaaggccgatatcagttccgatcagattgccgctatcggtatc
accaaccaacgtgaaaccgcgatcgtctgggaacgtgaaaccggcaaaccgatatacaac
gctattgtctggcagtgccgtcgtaccgccgatatttgcgaacagcttaaacgcgacggc
ctggaagattacatccgcgacaataccggtctggtcgtcgacccgtacttctctggcact
aaagtgaaatggatccttgaccatgtggaaggttcgcgcgaacgcgcgaagcgtggcgag
ctgctgttcggtacggtggatacctggcttatctggaagatgacgcagggccgcgtccac
gttacggattacaccaacgcctcacgaaccatgctgttcaacatccatgatttggactgg
gacgataagatgctggacgtgctggatatcccacgcgcgatgctgccccaggtacgtaag
tcctccgaagtctacggccagaccaatattggcggtaaaggcggtacacgtattcctatc
gccgggattgccggggatcagcaggccgcgttattcggtcaactgtgcgtaaaggaagga
atggcaaagaatacctacggcaccggctgctttatgctgatgaacaccggcgagaaagcg
gtaaaatcggaaaacggcctgctgaccaccatcgcctgcggcccaagcggcgaagtcaac
tatgcgctggaaggcgcggtgtttatggcgggagcgtccattcaatggctgcgtgatgaa
atgaagctcatcagcgacgcgttcgactccgaatatttcgccacgaaagtgaaagatacc
aacggtgtctacgtggttccggccttcaccggtctgggcgcgccgtactgggacccgtat
gcccgcggcgccatttttggcctgacccgcggcgtgaactctaatcacattatccgcgcg
acgctcgaatccatcgcttaccagacccgcgacgtactggaagcgatgcaggccgactcc
ggtatccgcctgcacgctctgcgtgtggacggcggcgcagtggccaacaacttcctgatg
cagttccagtcagatattctcggcacgcgggtggaacgcccggaagtgcgcgaagtgacc
gcgctgggcgccgcctatctggctggcctggccgtcggttactggcagaacctggacgag
ctgcaggaaaaagccgtcattgagcgagaattccgccccggcattgaaaccaccgagcgt
aactaccgttacagcggctggaagaaagcggttaaacgcgcaatggcgtgggaagagcac
gacaagtaa

DBGET integrated database retrieval system