KEGG   Salmonella enterica subsp. enterica serovar Typhimurium UK-1: STMUK_4412Help
Entry
STMUK_4412        CDS       T01743                                 

Gene name
srfJ
Definition
lysosomal glucosyl ceramidase-like protein
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
sej  Salmonella enterica subsp. enterica serovar Typhimurium UK-1
Pathway
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:sej00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Structure
PDB: 

Jmol
Position
4629451..4630794
Genome map
AA seq 447 aa AA seqDB search
MKGRLISSDPYRQQFLVERAVSFSHRQRDCSELISVLPRHALQQIDGFGGSFTEGAGVVF
NSMSEKTKAQFLSLYFSAQEHNYTLARMPIQSCDFSLGNYAYVDSSADLQQGRLSFSRDE
AHLIPLISGALRLNPHMKLMASPWSPPAFMKTNNDMNGGGKLRRECYADWADIIINYLLE
YRRHGINVQALSVQNEPVAVKTWDSCLYSVEEETAFAVQYLRPRLARQGMDEMEIYIWDH
DKDGLVDWAELAFADEANYKGINGLAFHWYTGDHFSQIQYLAQCLPDKKLLFSEGCVPME
SDAGSQIRHWHTYLHDMIGNFKSGCSGFIDWNLLLNSEGGPNHQGNLCEAPIQYDAQNDV
LRRNHSWYGIGHFCRYVRPGARVMLSSSYDNLLEEVGFVNPDGERVLVVYNRDVQERRCR
VLDGDKEIALTLPPSGASTLLWRQESI
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggcagactcatctcttccgatccgtatcgtcagcaattccttgttgagcgtgcg
gtctctttttcgcatcgtcagcgtgattgcagtgaattaatcagcgtcttaccgcgccac
gcgttacagcagattgacggattcggcggcagctttaccgaaggtgcgggcgtggtattc
aacagcatgagcgaaaagacgaaggcgcaatttctttccctttatttttctgctcaggaa
cataattacactctggcgcggatgccaattcagagctgtgatttttccctgggcaattac
gcgtatgtcgattccagcgctgacctgcagcagggacggctctccttttcccgcgatgaa
gcgcatttaataccgctgatttccggggcgttgcggttaaatccacacatgaagctgatg
gcttcgccgtggagtccgccggcgtttatgaaaactaataacgatatgaacggtggcggc
aagctgcggcgcgaatgctacgccgactgggccgatatcattatcaactacctgctggaa
taccgccgccacggcattaatgtgcaggcgctctccgtgcagaatgagccggtggcggta
aaaacctgggactcctgtctgtatagcgtggaagaggagacagcctttgccgtgcagtat
ctgcgtccgcgcctcgcccggcagggtatggatgagatggagatctatatctgggatcac
gataaagatggcctggtggactgggctgaactcgcctttgctgacgaagctaattataag
ggaattaacgggctggcattccactggtataccggcgaccatttttcgcaaatacagtat
ctggcccagtgcctgccggataaaaaactcctgttttccgaaggctgtgtgccaatggag
agcgatgccggtagccagattcgccactggcatacctatctccatgacatgattggtaat
ttcaaatcgggttgtagcgggtttatcgactggaatctgctgctgaacagtgagggcggg
ccgaatcatcagggtaatctgtgtgaagcgcccattcaatacgatgcgcaaaacgacgtg
ctgcggcgtaaccactcctggtatggtattggccacttctgccgctatgtgcgtccgggg
gcgagggtcatgctttcttcaagttacgataatcttctggaagaggtgggatttgtgaat
cccgacggcgagcgtgtgctggtggtgtataaccgcgatgtccaggaaaggcgttgccgg
gtgctggatggcgataaagagatcgcgttaacgctgccgccgtcaggcgccagtacgttg
ctatggcggcaggagtcgatctga

DBGET integrated database retrieval system